You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable phospholipid-transporting ATPase DNF3
SynonymsNot Available
Gene NameDNF3
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionThis magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of phospholipids (Potential)
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB Pathways
Lysolipid incorporation into ERPW002532 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(10:0/10:0)PW002780 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(14:0/14:0)PW002783 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(16:0/16:0)PW002784 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(16:1(11Z)/16:1(11Z))PW002786 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
adenyl nucleotide binding
hydrolase activity, acting on acid anhydrides
adenyl ribonucleotide binding
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
ATP binding
ion binding
cation binding
substrate-specific transporter activity
metal ion binding
lipid transporter activity
transporter activity
phospholipid transporter activity
transmembrane transporter activity
phospholipid-translocating ATPase activity
hydrolase activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
binding
magnesium ion binding
catalytic activity
nucleoside binding
ATPase activity, coupled to transmembrane movement of ions
purine nucleoside binding
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
Process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
establishment of localization
lipid transport
nucleoside phosphate metabolic process
transport
phospholipid transport
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR162C
Gene Sequence>4971 bp ATGGGCATAGCTGATGGGCAAAGAAGAAGATCTTCATCACTACGAACGCAGATGTTCAAC AAGCATTTGTATGATAAATATCGCGGAAGAACTGATGATGAGATAGAGTTAGAAGATATA AATGAGAGTAAGACGTTCTCCGGTAGCGATAATAACGATAAAGATGACAGAGATGAAACA AGCGGCAATTATGCTGCTGAAGAGGATTATGAAATGGAAGAGTATGGTAGTCCTGATGTG TCATATAGCATTATCACTAAAATACTTGATACTATCCTAGATCGAAGGAGGACGTTCCAT TCGAAAGACGGTAGACATATTCCGATTATATTAGATCATAATGCAATTGAATACAAACAA GCTGCTACTAAAAGGGATGGTCATTTGATAGACGAAAGGTTCAACAAGCCTTACTGCGAC AACCGAATAACTTCATCAAGATATACATTCTATTCCTTTTTGCCTAGACAGTTGTATGCA CAATTTTCAAAGTTAGCCAATACTTATTTTTTCATTGTCGCAGTATTACAAATGATACCT GGATGGTCTACAACTGGTACTTATACAACTATTATCCCCTTATGTGTATTTATGGGTATA TCCATGACAAGAGAGGCTTGGGACGATTTCAGGAGACATCGTTTAGATAAGGAAGAGAAC AATAAACCAGTGGGAGTGTTGGTTAAAGATGGAAATAATGACGCACAAGAAGTTTATACA CTACCAAGTAGTGTTGTCTCATCCACTGCATATCTAACTAAATCGGCCGCTGCTGAAAAT AATCCACCTTTAAACGATGATCGGAACTCCTCTCAAGGACACTTCTTAGACACGCACTTC AATAACTTTGAACTACTCAAGAATAAATACAATGTTCATATTCATCAAAAGAAGTGGGAA AAACTTCGTGTTGGAGACTTCGTACTTCTCACACAAGATGATTGGGTACCTGCAGATCTG CTTTTATTGACATGTGACGGCGAAAATAGCGAATGTTTCGTTGAAACGATGGCTTTAGAT GGCGAAACAAATTTGAAAAGTAAACAACCCCATCCAGAATTAAATAAGTTAACCAAAGCC GCATCAGGTCTTGCAAATATTAATGCTCAAGTTACCGTGGAAGATCCCAATATTGATTTA TATAATTTTGAAGGTAATCTTGAATTGAAAAACCATCGCAATGATACCATAATGAAATAC CCTCTAGGTCCTGATAATGTCATTTATCGTGGTAGTATTTTGAGGAATACTCAAAATGTT GTTGGTATGGTCATTTTCAGTGGTGAGGAAACAAAAATCAGAATGAATGCTTTAAAAAAC CCAAGAACGAAAGCCCCTAAGCTACAAAGGAAGATAAATATGATTATCGTGTTTATGGTG TTTGTCGTTGCCACAATATCTTTATTTTCTTATCTTGGCCATGTTTTGCATAAGAAAAAA TATATCGACCAGAACAAAGCATGGTATCTATTTCAGGCAGATGCTGGCGTAGCACCCACA ATAATGTCTTTTATCATCATGTATAACACTGTGATTCCTTTGTCCCTATATGTAACAATG GAAATTATCAAGGTAGTCCAAAGTAAAATGATGGAATGGGACATAGACATGTACCATGCA GAAACGAACACGCCATGCGAATCGAGAACTGCCACCATTCTGGAGGAATTGGGGCAAGTA TCTTATATTTTTAGTGATAAAACCGGAACGCTGACGGATAATAAGATGATATTTCGGAAA TTTTCTTTATGTGGATCATCTTGGCTGCATAATGTAGATCTCGGTAATTCTGAGGATAAC TTTGAAGACAACAGAGACAATACGAACTCCTTGAGACTACCACCAAAAGCTCACAACGGC TCTAGTATAGACGTTGTTTCCATTGGAGATCAAAATGTTCTTGATCGGTTAGGATTTTCG GACGCACCAATTGAAAAAGGGCATCGTCCATCTTTGGACAACTTTCCTAAATCTAGGAAT TCTATTGAATATAAGGGAAATTCATCAGCAATTTATACAGGCCGTCCCAGTATGAGATCA CTTTTTGGGAAAGATAATTCACATCTAAGTAAACAAGCTTCGGTTATTTCACCCTCCGAG ACATTTTCGGAGAACATTAAAAGTTCGTTTGATTTAATTCAGTTTATTCAAAGATATCCG ACCGCCCTGTTTTCTCAAAAGGCTAAATTTTTCTTCTTATCATTAGCTCTTTGTCATAGC TGTCTTCCCAAAAAAACTCATAACGAATCAATAGGAGAAGACTCCATAGAGTATCAGTCT TCATCTCCAGATGAATTAGCACTAGTAACCGCTGCTAGAGACCTTGGTTATATTGTATTG AATAGAAATGCACAGATTTTGACCATTAAAACTTTTCCAGACGGTTTTGACGGTGAAGCA AAATTGGAAAATTATGAAATTTTGAACTATATTGACTTCAATTCTCAAAGAAAGAGAATG TCTGTTCTTGTACGTATGCCAAATCAACCAAATCAAGTTCTTTTAATTTGCAAAGGTGCT GATAACGTTATTATGGAGCGTTTACATGATCGCGAATTGGCTGCCAAAAAAATGGCAGAC ATATGCACCAGTACCAAAGAACGTAAAGACGCAGAAGCAGAGCTGGTTCTCCAGCAAAGA AAGTCTCTGGAAAGAATGGTAGATGAAGAGGCTATGGCCAGGACCTCATTGAGAAATTCT TTGTCTAGCGTACCGAGAGCAAGTTTATCATTGCAGGCAGTGAGAAAAAGTCTTTCAATG AAGAACAGCAGGACCCGTGATCCAGAGAAACAAATTGACTCCATTGATCAATTTCTAGAA ACGGTCAAGAAATCTGATCAGGAGATTGGCAGCGTTGTAAATAAAAGCAGGAAGTCACTC CATAAGCAACAAATAGAAAAATATGGGCCGCGAATTTCGATAGATGGAACACATTTTCCG AACAACAATGTCCCAATAGACACAAGAAAAGAAGGACTACAGCATGATTACGATACAGAA ATTTTGGAGCACATTGGAAGCGATGAGTTAATTTTGAATGAAGAGTATGTTATTGAAAGA ACTTTGCAAGCCATCGATGAGTTTTCGACTGAAGGCTTAAGAACTCTGGTCTATGCTTAC AAATGGATCGATATTGGGCAGTATGAAAATTGGAATAAACGCTATCACCAAGCCAAAACC TCCCTTACTGATAGAAAAATCAAAGTCGATGAGGCAGGTGCAGAAATCGAGGATGGTTTA AATCTGTTAGGGGTAACTGCAATCGAAGACAAGTTACAAGACGGCGTTTCAGAAGCTATA GAAAAGATCAGAAGAGCCGGTATAAAAATGTGGATGCTAACAGGGGATAAAAGGGAAACG GCTATAAATATAGGGTATTCGTGTATGTTAATCAAAGATTATTCTACGGTAGTCATTTTA ACTACTACTGATGAAAATATTATATCAAAGATGAATGCGGTTTCTCAAGAAGTTGATTCC GGAAACATAGCACACTGCGTTGTTGTAATTGACGGTGCCACGATGGCCATGTTTGAAGGA AATCCTACATACATGTCTGTATTTGTTGAGCTTTGCACTAAAACAGACTCGGTAATATGT TGCCGTGCTTCACCTTCTCAAAAAGCCCTTATGGTTTCCAACATAAGAAATACCGATCCA AACTTAGTCACGTTGGCAATAGGTGATGGTGCGAATGATATTGCCATGATACAATCTGCC GATATAGGTGTTGGAATAGCCGGTAAGGAGGGATTGCAAGCATCTAGAGTATCTGATTAT TCTATTGGCCAATTTCGGTTTCTCTTGAAATTGTTATTTGTTCATGGGCGTTATAACTAT ATTCGCACCTCCAAGTTTATGCTTTGCACGTTTTACAAAGAAATTACGTTTTACTTTACG CAGTTGATATATCAAAGATATACAATGTTTTCAGGCTCCTCTCTATATGAGCCATGGTCA TTGTCCATGTTCAATACTCTATTCACATCACTACCGGTTCTATGTATTGGTATGTTTGAG AAAGACTTGAAACCAATGACTCTACTAACAGTCCCTGAATTATATTCGTACGGGCGCCTT TCACAAGGTTTTAATTGGTTAATATTCATGGAGTGGGTTATCTTGGCAACTACGAATTCT CTTATCATTACATTTTTAAATGTTGTAATGTGGGGTATGAGTTCTCTTTCAGATAACACT ATGTATCCTCTAGGTCTCATCAATTTCACAGCCATTGTTGCCTTAATTAACGTTAAATCC CAATTTGTTGAAATGCACAATAGGAATTGGCTGGCTTTTACTTCTGTAGTTCTATCCTGT GGAGGTTGGTTAGTGTGGTGTTGTGCCCTTCCTATTTTGAATAATACTGACCAAATATAT GATGTAGCATATGGCTTTTACAATCATTTTGGTAAAGACATTACATTCTGGTGTACTAGC TTGGTGTTGGCACTGTTACCTATCACTTTAGATATAGTTTACAAAACATTCAAAGTTATG ATATGGCCATCAGATTCTGATATTTTTGCTGAGCTGGAACAAAAAAGTGATATCAGAAAG AAGCTGGAACTAGGAGCCTATAGCGAAATGAGGCAAGGATGGACGTGGGATAAAGATCCC AGTACTTTCACAAGGTACACAGACAAAGTTCTTTCAAGGCCAAGAACTAATTCACGTGCA AGTGCAAAAACTCATAACAGCAGCATATATTCAATGTCAAATGGGAATGTAGACCATTCC TCAAAAAAAAATTTCTTTGGAAACTCTTCTAAAAAGAGCTCTGAACGATACGAGGTATTA CCTAGTGGCAAGTTAATCAAGCGACCATCCTTGAAAACACAAAGCAGTAAAGACAGTATT GGCGGCAATATAACTACTAAACTGACGAAGAAACTGAAGCTTCCATCGAGGAATGTGGAA GATGAAGATGTGAACCAGATTATTCAGGCAAGGCTAAAGGATCTGGAGTAA
Protein Properties
Pfam Domain Function
Protein Residues1656
Protein Molecular Weight188318.0
Protein Theoretical pI6.74
Signalling Regions
  • None
Transmembrane Regions
  • 165-185
  • 452-472
  • 496-516
  • 1158-1178
  • 1319-1339
  • 1366-1386
  • 1396-1416
  • 1433-1453
  • 1474-1494
Protein Sequence>Probable phospholipid-transporting ATPase DNF3 MGIADGQRRRSSSLRTQMFNKHLYDKYRGRTDDEIELEDINESKTFSGSDNNDKDDRDET SGNYAAEEDYEMEEYGSPDVSYSIITKILDTILDRRRTFHSKDGRHIPIILDHNAIEYKQ AATKRDGHLIDERFNKPYCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIP GWSTTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVLVKDGNNDAQEVYT LPSSVVSSTAYLTKSAAAENNPPLNDDRNSSQGHFLDTHFNNFELLKNKYNVHIHQKKWE KLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKA ASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNV VGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKK YIDQNKAWYLFQADAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHA ETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWLHNVDLGNSEDN FEDNRDNTNSLRLPPKAHNGSSIDVVSIGDQNVLDRLGFSDAPIEKGHRPSLDNFPKSRN SIEYKGNSSAIYTGRPSMRSLFGKDNSHLSKQASVISPSETFSENIKSSFDLIQFIQRYP TALFSQKAKFFFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVL NRNAQILTIKTFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGA DNVIMERLHDRELAAKKMADICTSTKERKDAEAELVLQQRKSLERMVDEEAMARTSLRNS LSSVPRASLSLQAVRKSLSMKNSRTRDPEKQIDSIDQFLETVKKSDQEIGSVVNKSRKSL HKQQIEKYGPRISIDGTHFPNNNVPIDTRKEGLQHDYDTEILEHIGSDELILNEEYVIER TLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAEIEDGL NLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDYSTVVIL TTTDENIISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVIC CRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDY SIGQFRFLLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWS LSMFNTLFTSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNS LIITFLNVVMWGMSSLSDNTMYPLGLINFTAIVALINVKSQFVEMHNRNWLAFTSVVLSC GGWLVWCCALPILNNTDQIYDVAYGFYNHFGKDITFWCTSLVLALLPITLDIVYKTFKVM IWPSDSDIFAELEQKSDIRKKLELGAYSEMRQGWTWDKDPSTFTRYTDKVLSRPRTNSRA SAKTHNSSIYSMSNGNVDHSSKKNFFGNSSKKSSERYEVLPSGKLIKRPSLKTQSSKDSI GGNITTKLTKKLKLPSRNVEDEDVNQIIQARLKDLE
References
External Links
ResourceLink
Saccharomyces Genome Database DNF3
Uniprot IDQ12674
Uniprot NameATC8_YEAST
GenBank Gene IDZ49705
Genebank Protein ID825567
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956