You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUDP-galactose transporter homolog 1
Synonyms
  • Multicopy suppressor of leflunomide-sensitivity protein 6
Gene NameHUT1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transport
Specific FunctionMay be involved in specific transport of UDP-Gal from the cytosol to the Golgi lumen. Involved in the maintenance of optimal conditions for the folding of secretory pathway proteins in the endoplasmic reticulum. Overexpression confers resistance to the immunosuppressive drug, leflunomide
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00692UDP-D-galactoseShow
GO Classification
Component
Not Available
Function
Not Available
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 16
LocusYPL244C
Gene Sequence>1020 bp ATGGCGGGAAGTACATCCAGTTTGGTGATCTGTGCGATTGGTATATATGCTACTTTTTTG ACGTGGGCATTAGTACAGGAGCCTTTGGCTACAAGAACCTGGCCAAACTCCATGGGAAAG TTTCAATTCCCTAATGTAATATCCCTCATACAAGCTTCTGTGGCAATGATGATGGGCTAC CTGTACTTAAACTGGAAGAAGGTGGAATATCCGCCCAGAAAAATGATTAAAGATCATTGG AAACAATTGATGTTGATATCATTTACACAGAGTAGTTCAGGCCCGCTGGCTACAACTTCT TTAAAGCACGTGGATTATCTCACTTACATGTTAGCAAAGTCATGCAAGATGATCCCCGTG TTGTTGGTGCATTTGCTTTTGTATAGGACGCCCATAGCAAGCCAAAAAAAAGTTGTAGCT CTCTTGGTAAGTCTCGGTGTCACTATTTTCACTATAGGTGGCAACGATGGTAAAAAGTTG AAGAGATCCTTTAATGAGAGCGGAAATGATAACAAATTACAAGGGTTTGGACTACTTTTC TCTAGTTTATTCCTTGATGGATTGACCAACGCCACCCAAGATAAGCTACTAAAGGCCAAT AAGGCCAAAGAAAAGGGAAAACAAACTTTGATAACAGGTGCACACTTGATGTTTACACTG AACCTCTTCGTGATATTGTGGAATATTTTGTATTTTATTGTGATCGACTGCAAACAATGG GATAATGCCGTTTCTGTATTGACGATGGACCCACAAGTGTGGGGCTATTTAATGCTTTAT TCGTTCTGTGGCGCTATGGGACAATGCTTTATTTTCTATACTCTAGAACAATTTGGCTCT TTAGTTTTGATCATGATAACAGTCACCAGGAAAATGGTCTCGATGATTTTGAGTATTATT GTCTTCGGTAAGAGTGTACGTTTCCAGCAATGGGTGGGGATGTTTATAGTATTTGGTGGA ATCACTTGGGAAGCACTCAACAAGAAGAAGGCTAATATACCGAAGGCAAAATCTGCGTAG
Protein Properties
Pfam Domain Function
Protein Residues339
Protein Molecular Weight38075.19922
Protein Theoretical pI10.32
Signalling Regions
  • None
Transmembrane Regions
  • 5-25
  • 43-63
  • 107-127
  • 137-157
  • 175-192
  • 215-235
  • 246-266
  • 281-303
  • 308-327
Protein Sequence>UDP-galactose transporter homolog 1 MAGSTSSLVICAIGIYATFLTWALVQEPLATRTWPNSMGKFQFPNVISLIQASVAMMMGY LYLNWKKVEYPPRKMIKDHWKQLMLISFTQSSSGPLATTSLKHVDYLTYMLAKSCKMIPV LLVHLLLYRTPIASQKKVVALLVSLGVTIFTIGGNDGKKLKRSFNESGNDNKLQGFGLLF SSLFLDGLTNATQDKLLKANKAKEKGKQTLITGAHLMFTLNLFVILWNILYFIVIDCKQW DNAVSVLTMDPQVWGYLMLYSFCGAMGQCFIFYTLEQFGSLVLIMITVTRKMVSMILSII VFGKSVRFQQWVGMFIVFGGITWEALNKKKANIPKAKSA
References
External Links
ResourceLink
Saccharomyces Genome Database HUT1
Uniprot IDQ12520
Uniprot NameHUT1_YEAST
GenBank Gene IDAY692836
Genebank Protein ID51013123
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Fujimura, H. (2001). "The Saccharomyces cerevisiae MLF6/YPL244C gene, which encodes a possible yeast homologue of mammalian UDP-galactose transporter, confers resistance to the immunosuppressive drug, leflunomide." Curr Microbiol 43:93-95.11391470
  • Kainuma, M., Chiba, Y., Takeuchi, M., Jigami, Y. (2001). "Overexpression of HUT1 gene stimulates in vivo galactosylation by enhancing UDP-galactose transport activity in Saccharomyces cerevisiae." Yeast 18:533-541.11284009
  • Nakanishi, H., Nakayama, K., Yokota, A., Tachikawa, H., Takahashi, N., Jigami, Y. (2001). "Hut1 proteins identified in Saccharomyces cerevisiae and Schizosaccharomyces pombe are functional homologues involved in the protein-folding process at the endoplasmic reticulum." Yeast 18:543-554.11284010
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258