You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInositol hexakisphosphate kinase 1
Synonyms
  • InsP6 kinase 1
  • InsP6 kinase KCS1
  • PKC1 suppressor protein 1
Gene NameKCS1
Enzyme Class
Biological Properties
General FunctionInvolved in inositol trisphosphate 3-kinase activity
Specific FunctionConverts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Involved in phosphate regulation and polyphosphate accumulation. Required for resistance to salt stress, cell wall integrity, vacuole morphogenesis, and telomere maintenance
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
phosphate + hydron + 4-Diphospho-1D-myo-inositol pentakisphosphate4,5-Bis(diphospho)-1D-myo-inositol tetrakisphosphate + water
Myo-Inositol hexakisphosphate + Adenosine triphosphate + hydron5-Diphosphoinositol pentakisphosphate + ADP
phosphate + hydron + 6-Diphospho-1D-myo-inositol pentakisphosphatewater + 5,6-Bis(diphospho)-1D-myo-inositol tetrakisphosphate
Adenosine triphosphate + hydron + phosphate + Inositol 1,3,4,5,6-pentakisphosphatewater + ADP + 5,6-Bis(diphospho)-1D-myo-inositol tetrakisphosphate
Myo-Inositol hexakisphosphate + phosphate + hydron5-Diphosphoinositol pentakisphosphate + water
Metabolites
YMDB IDNameView
YMDB000135-Diphosphoinositol pentakisphosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00500Myo-Inositol hexakisphosphateShow
YMDB005014-Diphospho-1D-myo-inositol pentakisphosphateShow
YMDB005024,5-Bis(diphospho)-1D-myo-inositol tetrakisphosphateShow
YMDB005215,6-Bis(diphospho)-1D-myo-inositol tetrakisphosphateShow
YMDB005236-Diphospho-1D-myo-inositol pentakisphosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00914ADPShow
YMDB00946Inositol 1,3,4,5,6-pentakisphosphateShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
inositol or phosphatidylinositol kinase activity
inositol trisphosphate kinase activity
inositol trisphosphate 3-kinase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR017C
Gene Sequence>3153 bp ATGGATACCTCTCACGAAATTCATGATAAAATACCCGATACATTAAGAGAGCAGCAGCAG CATTTGCGCCAAAAAGAGTCGGAAGGGTGCATAACAACATTGAAAGATCTTAATGTACCT GAGACGAAGAAACTTTCCTCCGTCTTACATGGCAGAAAGGCGAGTACATATTTAAGAATT TTTAGAGATGATGAATGTTTAGCCGATAACAACAATGGTGTAGATAGCAATAATGGCGGG TCCGTGACATGCGCGGACAAAATAACAAGGTCAGAAGCAACTCCCAAATCGGTACCAGAA GGACTACAAGTTTCTGAAAAAAAGAATAACCCAGATACTTTGTCCTCTTCATTGTCAAGT TTCATTTTATCTAACCACGAGGAGCCGGCAATTAAGCCCAATAAACACGTGGCGCATAGA AATAATATTACTGAGACAGGTCAAGGCTCTGGTGAGGATATCGCAAAACAACAATCACAC CAACCACAGGTGTTACACCACCAGACTTCTTTAAAGCCAATTCAGAATGTTGATGAGGGA TGTATTTCGCCTAAGTCCACTTATCAGGAGAGCTTACATGGAATATCGGAGGACTTAACG TTAAAGCCTGTTTCTTCTGCAACATACTATCCTCACAAAAGTAAAGCAGATTCTGGTTAT GAAGAAAAGGATAAAATGGAAAATGATATTGATACTATTCAGCCTGCCACCATAAATTGT GCCTCTGGTATAGCGACACTTCCTAGTTCATATAACCGACATACTTTCAAAGTTAAGACA TATTCAACTTTATCACAATCCCTAAGGCAAGAAAACGTCAACAATCGTAGTAACGAAAAA AAACCTCAACAGTTTGTGCCACATAGCGAATCAATTAAAGAAAAACCCAATACGTTTGAA CAAGATAAAGAAGGCGAGCAAGCGGACGAAGAAGAGGATGAAGGTGATAATGAACATAGG GAATATCCCCTAGCAGTTGAACTAAAACCATTTACGAATAGAGTTGGAGGTCACACTGCA ATATTCAGATTTTCGAAGAGAGCGGTTTGTAAGGCTCTAGTGAATAGAGAAAACAGGTGG TATGAGAATATAGAGCTGTGCCATAAAGAATTATTGCAATTCATGCCACGTTATATTGGT GTCCTGAATGTTAGGCAACATTTTCAGTCAAAAGATGACTTTTTAAGCGATTTGGATCAA GAAAACAACGGTAAAAATGATACCAGTAATGAAAACAAAGACATAGAAGTCAATCATAAC AATAACGACGATATTGCGCTTAATACAGAACCCACGGGGACCCCCTTAACACACATACAT TCCTTCCCCTTGGAACATTCGTCGAGACAAGTACTTGAAAAAGAGCATCCTGAAATTGAG TCTGTCCATCCACACGTGAAAAGATCACTGTCAAGTTCCAACCAACCTTCCTTGTTGCCC GAGGTTGTATTAAATGATAACAGGCATATTATACCGGAATCTCTGTGGTACAAATATTCC GATTCTCCAAACTCGGCACCGAATGATTCGTACTTTTCGTCCTCCTCTTCTCATAACTCA TGTTCGTTCGGTGAGCGTGGCAATACAAATAAATTAAAAAGACGCGATTCTGGGTCCACC ATGATCAATACTGAATTGAAGAACCTAGTCATAAGGGAAGTATTTGCACCGAAATGTTTT AGAAGGAAAAGAAACTCTAATACGACTACAATGGGAAACCATAATGCGCGTTTGGGTTCC AGTCCATCTTTTTTAACACAAAAATCAAGAGCCTCGTCCCATGATGCATCGAATACGTCT ATGAAGACTCTTGGTGATTCATCGTCACAAGCGAGTTTACAGATGGATGACTCGAAAGTC AATCCGAATTTGCAGGATCCTTTCTTGAAAAAATCGCTTCATGAAAAAATATCTAATGCT TTAGATGGCTCGCATTCAGTAATGGATTTGAAGCAATTCCACAAAAACGAACAAATAAAA CATAAAAACTCTTTCTGCAACTCTTTATCACCCATTCTCACTGCAACCAATTCTAGAGAT GATGGCGAATTTGCCACCTCCCCGAATTATATCAGCAACGCACAAGATGGTGTTTTTGAT ATGGATGAAGATACGGGAAACGAAACTATAAATATGGATAACCACGGCTGCCATCTTGAC TCTGGTAAAAACATGATTATAAAGTCATTGGCGTATAATGTTTCAAATGACTATAGTCAT CATGATATTGAATCAATTACGTTTGAGGAGACGTCCCACACCATTGTTTCAAAATTTATC TTATTGGAAGATTTGACAAGAAACATGAACAAGCCTTGTGCACTGGATCTAAAGATGGGG ACAAGACAATATGGCGTAGACGCCAAAAGAGCCAAGCAACTGTCACAGCGTGCAAAGTGT TTAAAGACCACTTCTAGGCGTTTAGGCGTTAGAATCTGCGGATTAAAGGTTTGGAACAAA GATTATTATATCACAAGAGATAAATACTTTGGTAGAAGGGTTAAGGTTGGTTGGCAATTT GCTAGGGTACTTGCACGTTTTTTGTATGATGGTAAGACCATTGAAAGTTTAATCAGGCAA ATTCCAAGGTTGATCAAGCAACTAGATACTTTGTATTCTGAAATTTTTAATTTGAAAGGT TACAGGCTATATGGCGCGTCTTTATTACTAATGTACGATGGAGATGCTAATAAATCAAAT TCTAAAAGGAAAAAAGCTGCTAATGTTAAAGTCAACTTGATCGATTTTGCACGTTGTGTT ACTAAAGAAGATGCAATGGAATGTATGGATAAATTTCGTATACCCCCAAAATCGCCAAAT ATAGAAGATAAAGGGTTCTTACGAGGTGTGAAGAGCTTGAGGTTTTATCTGTTATTAATC TGGAATTATCTGACTTCTGATATGCCGTTAATTTTCGATGAAGTAGAGATGAATGATATG ATTAGCGAAGAAGCAGATTCGAATAGTTTCACCTCCGCCACCGGTTCGAAAATCAACTTC AACAGTAAGTGGGATTGGTTAGATGAATTTGACAAAGAAGACGAAGAAATGTATAATGAT CCAAATAGTAAACTAAGACAAAAATGGAGAAAATACGAGCTTATTTTCGACGCTGAACCA AGATACAATGACGATGCTCAAGTTAGTGATTGA
Protein Properties
Pfam Domain Function
Protein Residues1050
Protein Molecular Weight119549.0
Protein Theoretical pI6.78
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inositol hexakisphosphate kinase 1 MDTSHEIHDKIPDTLREQQQHLRQKESEGCITTLKDLNVPETKKLSSVLHGRKASTYLRI FRDDECLADNNNGVDSNNGGSVTCADKITRSEATPKSVPEGLQVSEKKNNPDTLSSSLSS FILSNHEEPAIKPNKHVAHRNNITETGQGSGEDIAKQQSHQPQVLHHQTSLKPIQNVDEG CISPKSTYQESLHGISEDLTLKPVSSATYYPHKSKADSGYEEKDKMENDIDTIQPATINC ASGIATLPSSYNRHTFKVKTYSTLSQSLRQENVNNRSNEKKPQQFVPHSESIKEKPNTFE QDKEGEQADEEEDEGDNEHREYPLAVELKPFTNRVGGHTAIFRFSKRAVCKALVNRENRW YENIELCHKELLQFMPRYIGVLNVRQHFQSKDDFLSDLDQENNGKNDTSNENKDIEVNHN NNDDIALNTEPTGTPLTHIHSFPLEHSSRQVLEKEHPEIESVHPHVKRSLSSSNQPSLLP EVVLNDNRHIIPESLWYKYSDSPNSAPNDSYFSSSSSHNSCSFGERGNTNKLKRRDSGST MINTELKNLVIREVFAPKCFRRKRNSNTTTMGNHNARLGSSPSFLTQKSRASSHDASNTS MKTLGDSSSQASLQMDDSKVNPNLQDPFLKKSLHEKISNALDGSHSVMDLKQFHKNEQIK HKNSFCNSLSPILTATNSRDDGEFATSPNYISNAQDGVFDMDEDTGNETINMDNHGCHLD SGKNMIIKSLAYNVSNDYSHHDIESITFEETSHTIVSKFILLEDLTRNMNKPCALDLKMG TRQYGVDAKRAKQLSQRAKCLKTTSRRLGVRICGLKVWNKDYYITRDKYFGRRVKVGWQF ARVLARFLYDGKTIESLIRQIPRLIKQLDTLYSEIFNLKGYRLYGASLLLMYDGDANKSN SKRKKAANVKVNLIDFARCVTKEDAMECMDKFRIPPKSPNIEDKGFLRGVKSLRFYLLLI WNYLTSDMPLIFDEVEMNDMISEEADSNSFTSATGSKINFNSKWDWLDEFDKEDEEMYND PNSKLRQKWRKYELIFDAEPRYNDDAQVSD
References
External Links
ResourceLink
Saccharomyces Genome Database KCS1
Uniprot IDQ12494
Uniprot NameKCS1_YEAST
GenBank Gene IDS81651
Genebank Protein ID1478442
General Reference
  • Huang, K. N., Symington, L. S. (1995). "Suppressors of a Saccharomyces cerevisiae pkc1 mutation identify alleles of the phosphatase gene PTC1 and of a novel gene encoding a putative basic leucine zipper protein." Genetics 141:1275-1285.8601473
  • Eide, L. G., Sander, C., Prydz, H. (1996). "Sequencing and analysis of a 35.4 kb region on the right [corrected] arm of chromosome IV from Saccharomyces cerevisiae reveal 23 open reading frames." Yeast 12:1085-1090.8896275
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Saiardi, A., Erdjument-Bromage, H., Snowman, A. M., Tempst, P., Snyder, S. H. (1999). "Synthesis of diphosphoinositol pentakisphosphate by a newly identified family of higher inositol polyphosphate kinases." Curr Biol 9:1323-1326.10574768
  • Saiardi, A., Caffrey, J. J., Snyder, S. H., Shears, S. B. (2000). "The inositol hexakisphosphate kinase family. Catalytic flexibility and function in yeast vacuole biogenesis." J Biol Chem 275:24686-24692.10827188
  • Dubois, E., Scherens, B., Vierendeels, F., Ho, M. M., Messenguy, F., Shears, S. B. (2002). "In Saccharomyces cerevisiae, the inositol polyphosphate kinase activity of Kcs1p is required for resistance to salt stress, cell wall integrity, and vacuolar morphogenesis." J Biol Chem 277:23755-23763.11956213
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • York, S. J., Armbruster, B. N., Greenwell, P., Petes, T. D., York, J. D. (2005). "Inositol diphosphate signaling regulates telomere length." J Biol Chem 280:4264-4269.15561716
  • Auesukaree, C., Tochio, H., Shirakawa, M., Kaneko, Y., Harashima, S. (2005). "Plc1p, Arg82p, and Kcs1p, enzymes involved in inositol pyrophosphate synthesis, are essential for phosphate regulation and polyphosphate accumulation in Saccharomyces cerevisiae." J Biol Chem 280:25127-25133.15866881
  • Seeds, A. M., Bastidas, R. J., York, J. D. (2005). "Molecular definition of a novel inositol polyphosphate metabolic pathway initiated by inositol 1,4,5-trisphosphate 3-kinase activity in Saccharomyces cerevisiae." J Biol Chem 280:27654-27661.15944147
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956