You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial aspartate-glutamate transporter AGC1
Synonyms
  • Aspartate-glutamate carrier 1
Gene NameAGC1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in binding
Specific FunctionCalcium-dependent mitochondrial aspartate and glutamate carrier. Transport of glutamate in mitochondria is required for mitochondrial transamination reactions and ornithine synthesis. Plays also a role in malate-aspartate NADH shuttle, which is critical for growth on acetate and fatty acids
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB Pathways
Aspartate metabolismPW002375 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00271L-Glutamic acidShow
YMDB00862hydronShow
YMDB00896L-Aspartic acidShow
GO Classification
Component
cell part
membrane
organelle membrane
organelle inner membrane
mitochondrial inner membrane
Function
binding
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 16
LocusYPR021C
Gene Sequence>2709 bp ATGGAGCAAATCAATTCGAACAGTAGAAAAAAGAAGCAACAATTGGAAGTATTCAAATAT TTTGCAAGTGTCCTTACAAAAGAGGACAAGCCTATTAGTATCAGTAATGGTATGTTAGAT ATGCCGACAGTGAACTCCAGTAAACTCACAGCAGGAAATGGGAAACCTGACACGGAGAAG CTTACAGGAGAACTAATTTTAACATACGACGATTTCATTGAACTGATATCTAGCTCAAAG ACTATTTATTCGAAGTTTACGGACCATTCGTTCAATTTGAACCAGATACCCAAGAACGTT TTCGGGTGTATTTTCTTCGCTATTGATGAACAAAACAAGGGATATCTGACGCTTAATGAT TGGTTTTATTTTAATAATTTATTAGAATATGATAATTATCATCTCATTATTCTATATGAG TTCTTTAGGAAATTTGATGTAGAGAATTTGAAGGCAAAACAAAAAAAAGAGCTTGGTAGT TCGTCGTTTAATTTAAAGGCTGCAGATGATCGAATTAAGTCAATTAATTATGGTAACAGA TTTCTAAGCTTTGATGATCTTCTTTTGAATCTGAACCAATTCAAAGATACTATCCGCCTG TTGCACGAATCTATTGATGATAATTTTGTTAAAGATAACAAATTACTACTTGATTGGAAT GACTTTCGATTTCTGAAATTTTACAAATGTTATCATGAAAATGAAGAGTATTTGAGTTTA AACTCTCTGGTCACGATTTTACAAAATGATCTTAAGAATGAAAAAATATTTATAGGTTTT GATAGGTTGGCACAGATGGACTCACAAGGGCATCGTTTAGCCCTAAGCAAAAATCAACTC ACCTATCTTCTAAGGTTATTTTACTCTCACAGGGTGTCTGCAGATATATTTTCCTCCTTG AATCTATCAAACACCGAATTACTAAAAGCGGACAATAATTCCATTCCGTACAATGTATTC AAGGATATATTTTATTTATTTCAAAATTTTGACCTACTGAACCAAATATTTCACAAGTAT GTTACTGAAAATAATTTGAATGAGCAGGATATTAGGGAACAAATAGTTACTAAAAATGAC TTTATGACAGTTTTAAACGCCCAGTATAACAAAGTAAACAATATCATTGAGTTCTCTCCT TCCCAAATCAACCTACTATTTTCTATCGTCGCAAATTCAAAGGAAAACAGAAGATTAAGA AAGAGAAATCAAGATCGAGATGACGAGCTATTAAATGATCACCATTATGATTCAGATATT GATTTTTTTATCCATAATGAGTATTTGCATGGAGTAAGCAGATCCAGAAAAAATTTAGAA AGTTTTAATGACTATTATCATGATCTCTCGGATGGATTTGACCAAGACTCTGGTGTTAAA AAAGCTTCAAAAGCGAGTACTGGCTTGTTTGAATCTGTATTTGGAGGTAAAAAAGATAAA GCAACGATGCGTTCTGACTTAACAATTGAAGATTTCATGAAAATTTTGAACCCAAATTAC CTGAACGACTTAGTTCACCAAATGGAATTGCAAAAAAATCAAAATGAGTCATTGTATATT AATTACTACTTTTATCCAATTTTCGATTCGTTGTACAATTTCTCCTTGGGTTCTATTGCG GGTTGTATTGGTGCAACTGTAGTATACCCAATAGACTTTATAAAAACAAGGATGCAAGCC CAAAGATCTTTAGCCCAATACAAAAACTCAATTGATTGTTTGTTGAAGATTATATCCCGC GAAGGAATAAAAGGTCTCTACTCTGGCTTAGGGCCACAATTAATAGGAGTTGCTCCTGAA AAGGCGATAAAATTGACTGTCAATGATTTTATGAGAAACAGGTTGACTGATAAAAACGGC AAGCTAAGCCTTTTTCCTGAAATTATTTCTGGCGCTTCAGCTGGTGCATGTCAAGTTATA TTTACTAATCCGTTAGAGATTGTAAAAATTAGGCTACAGGTCCAATCCGACTATGTTGGT GAAAACATACAACAAGCCAATGAAACTGCCACTCAAATAGTCAAAAAATTAGGACTGAGG GGCTTGTACAATGGTGTAGCCGCATGTTTAATGAGAGATGTTCCATTCTCTGCTATTTAT TTTCCCACTTATGCACATTTAAAAAAAGATCTCTTTGATTTTGATCCAAATGATAAAACA AAGAGGAATCGATTAAAAACATGGGAGCTTTTAACTGCCGGTGCCATTGCTGGTATGCCA GCTGCCTTCTTGACTACTCCTTTTGATGTTATAAAAACAAGGCTCCAGATAGATCCTCGA AAAGGTGAGACAAAGTATAACGGTATATTTCATGCTATCCGAACTATCTTAAAGGAAGAG AGCTTTAGAAGCTTTTTCAAAGGTGGTGGAGCCCGTGTCCTAAGAAGTTCTCCCCAATTT GGGTTCACTCTGGCCGCCTATGAATTATTCAAGGGCTTTATTCCCTCCCCCGATAACAAA TTAAAAAGCAGAGAGGGTAGGAAGAGATTTTGTATCGATGACGACGCAGGCAATGAAGAG ACAGTAGTTCATAGTAACGGTGAACTCCCACAGCAAAAGTTTTACTCTGATGATAGAAAA CATGCCAATTATTACTATAAAAGCTGTCAAATTGCGAAAACATTCATTGATTTGGACAAT AACTTTTCTAGGTTTGACTCTTCAGTTTATAAAAACTTTCAAGAGCACCTAAGAAGCATT AACGGGTGA
Protein Properties
Pfam Domain Function
Protein Residues902
Protein Molecular Weight104303.0
Protein Theoretical pI8.16
Signalling Regions
  • None
Transmembrane Regions
  • 534-554
  • 591-611
  • 622-642
  • 681-702
  • 731-751
  • 786-806
Protein Sequence>Mitochondrial aspartate-glutamate transporter AGC1 MEQINSNSRKKKQQLEVFKYFASVLTKEDKPISISNGMLDMPTVNSSKLTAGNGKPDTEK LTGELILTYDDFIELISSSKTIYSKFTDHSFNLNQIPKNVFGCIFFAIDEQNKGYLTLND WFYFNNLLEYDNYHLIILYEFFRKFDVENLKAKQKKELGSSSFNLKAADDRIKSINYGNR FLSFDDLLLNLNQFKDTIRLLHESIDDNFVKDNKLLLDWNDFRFLKFYKCYHENEEYLSL NSLVTILQNDLKNEKIFIGFDRLAQMDSQGHRLALSKNQLTYLLRLFYSHRVSADIFSSL NLSNTELLKADNNSIPYNVFKDIFYLFQNFDLLNQIFHKYVTENNLNEQDIREQIVTKND FMTVLNAQYNKVNNIIEFSPSQINLLFSIVANSKENRRLRKRNQDRDDELLNDHHYDSDI DFFIHNEYLHGVSRSRKNLESFNDYYHDLSDGFDQDSGVKKASKASTGLFESVFGGKKDK ATMRSDLTIEDFMKILNPNYLNDLVHQMELQKNQNESLYINYYFYPIFDSLYNFSLGSIA GCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIGVAPE KAIKLTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVG ENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKT KRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEE SFRSFFKGGGARVLRSSPQFGFTLAAYELFKGFIPSPDNKLKSREGRKRFCIDDDAGNEE TVVHSNGELPQQKFYSDDRKHANYYYKSCQIAKTFIDLDNNFSRFDSSVYKNFQEHLRSI NG
References
External Links
ResourceLink
Saccharomyces Genome Database AGC1
Uniprot IDQ12482
Uniprot NameAGC1_YEAST
GenBank Gene IDZ49274
Genebank Protein ID809586
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • el Moualij, B., Duyckaerts, C., Lamotte-Brasseur, J., Sluse, F. E. (1997). "Phylogenetic classification of the mitochondrial carrier family of Saccharomyces cerevisiae." Yeast 13:573-581.9178508
  • Cavero, S., Vozza, A., del Arco, A., Palmieri, L., Villa, A., Blanco, E., Runswick, M. J., Walker, J. E., Cerdan, S., Palmieri, F., Satrustegui, J. (2003). "Identification and metabolic role of the mitochondrial aspartate-glutamate transporter in Saccharomyces cerevisiae." Mol Microbiol 50:1257-1269.14622413
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278