You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable 2-methylcitrate dehydratase
SynonymsNot Available
Gene NamePDH1
Enzyme Class
Biological Properties
General FunctionInvolved in 2-methylcitrate dehydratase activity
Specific FunctionCatalyzes the dehydration of 2-methylcitrate to 2- methyl-cis-aconitate
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Propanoate metabolismec00640 Map00640
SMPDB ReactionsNot Available
KEGG Reactions
(2S,3S)-2-Methylcitric acidMethylisocitric acid
Metabolites
YMDB IDNameView
YMDB00380cis-2-MethylaconitateShow
YMDB00535(2S,3R)-3-hydroxybutane-1,2,3-tricarboxylic acidShow
YMDB00978(2S,3S)-2-Methylcitric acidShow
GO Classification
Component
Not Available
Function
2 iron, 2 sulfur cluster binding
2-methylcitrate dehydratase activity
catalytic activity
lyase activity
binding
metal cluster binding
iron-sulfur cluster binding
carbon-oxygen lyase activity
hydro-lyase activity
Process
oxoacid metabolic process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
propionate metabolic process
metabolic process
propionate catabolic process
propionate catabolic process, 2-methylcitrate cycle
cellular metabolic process
organic acid metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR002W
Gene Sequence>1551 bp ATGTTTTTAGCCAAAAATCTAAAAAATAATAAAATCAAGGTATGCTTGCCTAAAAAGAAA TTTGCTGCGCTGAGTACAGCGTCTATACAAACTAATGAAAGACCAAATCCAGATAAGGTT TTGAAGGACATCGCGAAATATGTCCATGAAACCCCATTAAAATCATCTTTGGCTCTAGAT ACAGCACGACTCTGTTTCCTTGATACTCTAGGCTGTGGCTTGGCGGCTTTGAAATTTAAG CAGGCTCAAAATATTATTAAACCAATTGTGCCAGGAACAATAGTTCCCAGTGGAACAAAA ATATTGGGCACATCTTACGTTATGGATCCAGTGAAGGGAGCTTTTGCCATTGGTACTCTA ATACGTTGGTTAGATTACAATGACTGCTGGTTAGCTGCCGAGTGGGGGCACCCATCAGAT AACCTTGGGGGAATTTTAGCTGTCGCGGATCACTTGTCCAGATTAAACAAGGCTACCCAC GGAAAGAATGGAAAACAGTTTCTTGTTAAAGACGTATTAGAGGCAATGATTAAAGCGCAT GAAATCCAAGGTATTATAGCGCTCGAAAATTCTTTCAATAAAGTAGGTTTAGATCATGTG GTACTCGTGAAAGTAGCAACGGCTGGTGTTGTCTCGAAGATGCTGGGCCTGAGCCAGGAA CAAACTATTGAAGCATTGTCACAAGCATTTGTAGACGGTCAATCACTGCGTACTTACCGT CATGCCCCAAATACTGGATCTAGAAAGTCGTGGGCGGCGGGAGATGCAGTTTCGAGGGCT GTAAACTTGGCTTATTTAGTCAAAAATGCTAATGTTGGCACGATACCTTCAGTATTAACA GCTAGAACCTGGGGATTTTATGACGTTTTATTTAAGGGTAAACCTTTTTCATTCCAACAA AGATCAAAATATGATTCCTACGTCATGGAAAACGTTCTGTTCAAGATATCATTTCCTGCC GAATTCCATGCGCAAACTGCTGTAGAAGCTGCTGTAAAAGCATATAGGATTCTTGCCAAA CAAGGGAAAACTTTTAAAGATATTAAATCGATCAGAATTAGAACTCAAGAGGCGGCAATG AGGATTATAGATAAATCCGGTCCTCTGTATAATTATGCCGATAGGGATCATTGTATCCAG TACATGATCGCGGTTCCGCTGATTACTGGTAATCTCACAGCTACTGATTATTCGGATGAG GTCGCAAGAAATCCTGAGATCGATAACTTGAGATCGAAAATGTACTGTATCGAAGATACT CATCTCACTCAAAACTATCACGATCCTGATAAAAGGTCGATAGGAAACGCTCTTCTCATA GAGCTGAACGATGGGACGCAGTTGGATGAAATTTTTGTAGAGTACCCTGTTGGTCACAAA TTTAGACGAGAGGAAGGAATACCATTACTAATGAATAAATTTCAAAGGCATCTGCGCGAA CATTTTGTAGAGAGCCCTGATAAAGTCGACCTTATAATGAAGGTAAGTTCAAAAACAAAC TTTTTGAATATGCAAATCGACAAATACATGGATTTGTTTACTGAGGGATGA
Protein Properties
Pfam Domain Function
Protein Residues516
Protein Molecular Weight57683.10156
Protein Theoretical pI9.51
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable 2-methylcitrate dehydratase MFLAKNLKNNKIKVCLPKKKFAALSTASIQTNERPNPDKVLKDIAKYVHETPLKSSLALD TARLCFLDTLGCGLAALKFKQAQNIIKPIVPGTIVPSGTKILGTSYVMDPVKGAFAIGTL IRWLDYNDCWLAAEWGHPSDNLGGILAVADHLSRLNKATHGKNGKQFLVKDVLEAMIKAH EIQGIIALENSFNKVGLDHVVLVKVATAGVVSKMLGLSQEQTIEALSQAFVDGQSLRTYR HAPNTGSRKSWAAGDAVSRAVNLAYLVKNANVGTIPSVLTARTWGFYDVLFKGKPFSFQQ RSKYDSYVMENVLFKISFPAEFHAQTAVEAAVKAYRILAKQGKTFKDIKSIRIRTQEAAM RIIDKSGPLYNYADRDHCIQYMIAVPLITGNLTATDYSDEVARNPEIDNLRSKMYCIEDT HLTQNYHDPDKRSIGNALLIELNDGTQLDEIFVEYPVGHKFRREEGIPLLMNKFQRHLRE HFVESPDKVDLIMKVSSKTNFLNMQIDKYMDLFTEG
References
External Links
ResourceLink
Saccharomyces Genome Database PDH1
Uniprot IDQ12428
Uniprot NamePRPD_YEAST
GenBank Gene IDU31900
Genebank Protein ID939736
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106