You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA (guanine-N(1)-)-methyltransferase TRM10
Synonyms
  • tRNA methyltransferase 10
Gene NameTRM10
Enzyme Class
Biological Properties
General FunctionInvolved in methyltransferase activity
Specific FunctionCatalyzes the formation of N(1)-methylguanine at position 9 (m1G9) in cytoplasmic tRNAs
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 15
LocusYOL093W
Gene Sequence>882 bp ATGTCCAATGATGAGATAAACCAGAACGAGGAAAAGGTGAAAAGAACACCACCTTTACCG CCTGTGCCAGAAGGCATGTCTAAAAAGCAATGGAAAAAAATGTGTAAAAGACAGAGATGG GAGGAGAATAAAGCCAAATACAATGCGGAACGCCGTGTAAAGAAGAAGAGACTTCGCCAT GAAAGAAGTGCGAAGATTCAAGAATACATTGACAGGGGAGAAGAGGTCCCGCAGGAATTG ATTAGAGAGCCTCGTATCAATGTGAATCAGACTGATTCTGGGATAGAGATCATACTTGAC TGTTCTTTTGATGAGTTAATGAACGACAAGGAAATAGTAAGCTTGTCTAACCAGGTCACC AGGGCATACTCCGCGAATAGAAGGGCGAACCATTTTGCAGAAATAAAGGTGGCCCCATTC GACAAAAGACTAAAGCAAAGGTTTGAAACTACTCTGAAAAATACCAATTATGAAAACTGG AACCATTTTAAATTCCTACCAGACGACAAAATCATGTTTGGAGATGAGCATATAAGTAAG GACAAAATAGTGTATTTAACGGCCGATACAGAGGAAAAGCTGGAGAAGCTGGAACCCGGG ATGCGATACATTGTTGGCGGCATTGTAGACAAGAATCGTTATAAAGAATTGTGTCTGAAG AAGGCCCAAAAGATGGGCATTCCTACGCGAAGATTGCCCATTGACGAGTACATCAATCTC GAAGGCAGAAGAGTGTTGACGACAACGCACGTCGTGCAACTCATGCTGAAATACTTTGAT GACCATAACTGGAAAAATGCCTTTGAAAGCGTTTTACCACCCAGAAAGCTGGATGCGGAA GCAAAATCCGCAAGCTCTTCGCCAGCTCCAAAGGACACATAG
Protein Properties
Pfam Domain Function
Protein Residues293
Protein Molecular Weight34520.19922
Protein Theoretical pI9.81
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA (guanine-N(1)-)-methyltransferase TRM10 MSNDEINQNEEKVKRTPPLPPVPEGMSKKQWKKMCKRQRWEENKAKYNAERRVKKKRLRH ERSAKIQEYIDRGEEVPQELIREPRINVNQTDSGIEIILDCSFDELMNDKEIVSLSNQVT RAYSANRRANHFAEIKVAPFDKRLKQRFETTLKNTNYENWNHFKFLPDDKIMFGDEHISK DKIVYLTADTEEKLEKLEPGMRYIVGGIVDKNRYKELCLKKAQKMGIPTRRLPIDEYINL EGRRVLTTTHVVQLMLKYFDDHNWKNAFESVLPPRKLDAEAKSASSSPAPKDT
References
External Links
ResourceLink
Saccharomyces Genome Database TRM10
Uniprot IDQ12400
Uniprot NameTRM10_YEAST
GenBank Gene IDX83121
Genebank Protein ID600465
General Reference
  • Zumstein, E., Pearson, B. M., Kalogeropoulos, A., Schweizer, M. (1995). "A 29.425 kb segment on the left arm of yeast chromosome XV contains more than twice as many unknown as known open reading frames." Yeast 11:975-986.8533473
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Jackman, J. E., Montange, R. K., Malik, H. S., Phizicky, E. M. (2003). "Identification of the yeast gene encoding the tRNA m1G methyltransferase responsible for modification at position 9." RNA 9:574-585.12702816
  • Hiley, S. L., Jackman, J., Babak, T., Trochesset, M., Morris, Q. D., Phizicky, E., Hughes, T. R. (2005). "Detection and discovery of RNA modifications using microarrays." Nucleic Acids Res 33:e2.15640439
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956