You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutathione S-transferase 2
Synonyms
  • GST-II
Gene NameGTT2
Enzyme Class
Biological Properties
General FunctionInvolved in protein binding
Specific FunctionRX + glutathione = HX + R-S-glutathione
Cellular LocationNot Available
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00160GlutathioneShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 12
LocusYLL060C
Gene Sequence>702 bp ATGAATGGCAGAGGTTTCCTGATTTACAATGGAGGTGAAAAGATGAAACAAAAAATGATA ATATATGACACACCCGCAGGGCCTTATCCGGCCCGAGTCCGCATTGCCTTGGCTGAGAAG AACATGCTATCAAGTGTGCAATTTGTGAGGATCAACCTCTGGAAGGGAGAGCACAAGAAG CCTGAATTTCTTGCCAAGAACTATTCAGGCACAGTGCCAGTGCTTGAACTTGATGACGGG ACTTTAATCGCTGAATGCACAGCCATTACTGAATACATTGATGCACTTGATGGTACACCC ACTCTTACCGGCAAAACACCGCTGGAAAAAGGCGTAATCCACATGATGAACAAACGCGCA GAGTTGGAACTGCTCGACCCTGTTAGTGTTTATTTTCACCATGCTACACCTGGATTGGGG CCTGAAGTCGAGCTTTACCAAAACAAAGAGTGGGGACTTCGCCAGCGCGACAAAGCCCTA CATGGAATGCATTATTTTGATACCGTTCTCAGAGAACGCCCATATGTTGCTGGTGATTCA TTCTCAATGGCTGACATCACAGTAATAGCTGGTCTAATATTTGCTGCAATTGTAAAACTA CAAGTGCCGGAAGAGTGCGAGGCGCTTCGAGCTTGGTATAAGAGAATGCAACAGCGCCCC AGCGTGAAGAAACTGCTAGAAATCCGTTCAAAATCCTCGTAA
Protein Properties
Pfam Domain Function
Protein Residues233
Protein Molecular Weight26339.40039
Protein Theoretical pI8.93
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutathione S-transferase 2 MNGRGFLIYNGGEKMKQKMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKK PEFLAKNYSGTVPVLELDDGTLIAECTAITEYIDALDGTPTLTGKTPLEKGVIHMMNKRA ELELLDPVSVYFHHATPGLGPEVELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDS FSMADITVIAGLIFAAIVKLQVPEECEALRAWYKRMQQRPSVKKLLEIRSKSS
References
External Links
ResourceLink
Saccharomyces Genome Database GTT2
Uniprot IDQ12390
Uniprot NameGST2_YEAST
GenBank Gene IDAY557940
Genebank Protein ID45269772
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Choi, J. H., Lou, W., Vancura, A. (1998). "A novel membrane-bound glutathione S-transferase functions in the stationary phase of the yeast Saccharomyces cerevisiae." J Biol Chem 273:29915-29922.9792709