You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameS-methylmethionine permease 1
SynonymsNot Available
Gene NameMMP1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionHigh-affinity S-methylmethionine (SMM) permease, required for utilization of S-methylmethionine as a sulfur source
Cellular LocationMembrane; Multi-pass membrane protein. Endoplasmic reticulum
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00347S-Methyl-L-methionineShow
YMDB00862hydronShow
GO Classification
Component
integral to membrane
cell part
membrane
membrane part
intrinsic to membrane
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 12
LocusYLL061W
Gene Sequence>1752 bp ATGGATGAATTTGAATCTACCAAACTTTCGAAGGTTCAGTTTTCCACTAGCGTGTTAAGT ACGCCTTCGAATGAAGGAAATAATCTAATACACAGATTCAAGAACTCTTTCAAGCGAAAT GATTCACCAGCGATCCAAGAAGGTTTGCTGTATTCGGAGCTTTCAGAGGAAGAAAAAATA CAATGGGACTTAGCCAACCAGCCGTATAAAAAGGTCCTAGATCAAAGACACCTGACCATG ATAGCCATTGGAGGTACTCTAGGGACGGGTCTTTTCATTGGTTTAGGGGAATCACTAGCG TCCGGACCTGCTTCTTTGCTAATTGGTTTCTTGTTGGTCGGCGCATCTATGCTCTGTGTT GTTCAGTGTGGGGCCGAACTTTCATGTCAGTACCCTGTTTCCGGCTCCTATGCGCTGCAC GCCAGTAGATTTATAGACCCATCAGTCGGCTTCAGTATAGGAATTAACTACTTATTGATG TGGCTCATATCTTACCCTAGCGAGCTGGTAGGATGTTCGCTTACCATCTCTTATTGGGCA CCATCGGTCAATCCTGCTGCCTGGGTTGCAATCGCGTTCGTTTTAAGCATGCTATTGAAT CTTTTTGGGGCAAGAGGCTTTGCAGAATCAGAGTTTTATATGTCAATTTTCAAAATTGTG GCTCTATTCATTTTTATAATTATTGGTATTGTTCTCATTGCAGGTGGTGGGCCTGATTCT ACTGGATACATCGGCACGAAGTATTGGCACGATCCAGGCTCCTTCGCTGTTCCTGTTTTC AAAAACCTCTGCAATACTTTTGTTTCGGCAGCATACTCCTTTAGTGGTACAGAAATGGTT GTTTTAACCAGCACTGAAGCAAGGAGTGTTTCCTCAGTCTCTCGGGCAGCGAAAGGTACG TTCTGGAGAATTATCATCTTTTATATTGTTACAGTGATTATAATTGGTTGCCTGGTCCCT TATAATGATCCTCGTCTGATTAGCGGTTCATCCAGTGAGGATATTACTGCTTCCCCGTTT GTTATTGCCTTGAGCAATACTGGTGCTATGGGAACAAGAGTGTCTCATTTTATGAATGCG GTCATCTTGATAGCCGTATTTTCTGTTTGCAATTCCTGCGTTTACGCATCCTCTAGATTG ATTCAGGGTTTGGCGACAGCAGGCCAACTTCCAAAGATCTGCGCTTACATGGACAGGAAT GGTCGGCCTTTAGTTGGCATGGCTATATGTGGCGCTTTTGGATTGTTAGGCTTTTTGGTT GTTTCCAAGAACCAGGGTACAGTTTTCACATGGTTGTTTGCGTTGTGTTCCATTTCATTT TTCACAACTTGGTTCTGTATTTGCTTCTGTCAAGTCAGATTTAGGATGGCAATGAAAGCT CAAGGAAGGTCAAAGGATGACATTATCTATAGATCGACATTAGGGATATACGGAGGAATT TTCGGCTGTATCTTAAATGTTCTATTGGTAATTGGAGAAATATATGTATCGGCTGCACCC GTGGGTAGTCCCAGTTCTGCTGCTAATTTCTTTGAATATTGTATGAGTATTCCCATAATG ATTGCTGTATATATTGGCCATAGAATTTACCGCAGAGACTGGAGACACTGGTACATCAAG CGGATGGATATTGACCTCGATAGCGGACATTCGTTAGAGGACTTCGAAGCCACCAAGCTT GAGAGGGATGAGGATAAGAAATACGTTTCCTCTAAGCCACTTTACTATAGGATCTATCGG TTTTTCTGTTAA
Protein Properties
Pfam Domain Function
Protein Residues583
Protein Molecular Weight64217.0
Protein Theoretical pI7.97
Signalling Regions
  • None
Transmembrane Regions
  • 78-96
  • 102-123
  • 144-164
  • 183-203
  • 216-236
  • 255-274
  • 299-319
  • 357-377
  • 403-423
  • 429-449
  • 474-494
  • 506-526
Protein Sequence>S-methylmethionine permease 1 MDEFESTKLSKVQFSTSVLSTPSNEGNNLIHRFKNSFKRNDSPAIQEGLLYSELSEEEKI QWDLANQPYKKVLDQRHLTMIAIGGTLGTGLFIGLGESLASGPASLLIGFLLVGASMLCV VQCGAELSCQYPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWA PSVNPAAWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDS TGYIGTKYWHDPGSFAVPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARSVSSVSRAAKGT FWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVIALSNTGAMGTRVSHFMNA VILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLV VSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGI FGCILNVLLVIGEIYVSAAPVGSPSSAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIK RMDIDLDSGHSLEDFEATKLERDEDKKYVSSKPLYYRIYRFFC
References
External Links
ResourceLink
Saccharomyces Genome Database MMP1
Uniprot IDQ12372
Uniprot NameMMP1_YEAST
GenBank Gene IDZ47973
Genebank Protein ID642323
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Rouillon, A., Surdin-Kerjan, Y., Thomas, D. (1999). "Transport of sulfonium compounds. Characterization of the s-adenosylmethionine and s-methylmethionine permeases from the yeast Saccharomyces cerevisiae." J Biol Chem 274:28096-28105.10497160
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258