Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAcyl-protein thioesterase 1
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionHydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates. Mediates the deacylation of G-alpha proteins such as GPA1 in vivo, but has weak or no activity toward palmitoylated Ras proteins. Has weak lysophospholipase activity in vitro; however such activity may not exist in vivo
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00069Palmitic acidShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
Process
Not Available
Gene Properties
Chromosome LocationNot Available
LocusYLR118C
Gene Sequence>684 bp ATGAATGGACTTAGAGTTGCAGCAAAAATTCAGCCAGCACGCCAAACTATCATATTCTTG CATGGATTAGGTGATACAGGTTCGGGATGGGGATTTTTAGCTCAGTATTTACAACAGAGA GACCCTGCCGCTTTCCAGCATACTAATTTTGTTTTTCCTAATGCTCCAGAGCTTCATGTG ACAGCAAACGGCGGTGCATTGATGCCTGCTTGGTTTGACATCTTGGAATGGGATCCTAGT TTTTCCAAAGTTGACAGTGACGGTTTTATGAATTCTTTGAATTCCATAGAAAAGACGGTT AAGCAAGAAATTGATAAAGGAATTAAACCGGAGCAGATTATTATCGGAGGTTTCTCTCAG GGTGCCGCATTAGCTCTCGCAACATCAGTTACTTTACCATGGAAAATCGGTGGTATAGTA GCTCTGTCGGGATTTTGTTCCATCCCAGGAATTCTGAAACAACATAAGAATGGCATTAAT GTAAAGACACCAATTTTTCATGGGCATGGTGACATGGATCCAGTAGTTCCTATTGGACTA GGTATAAAGGCAAAACAGTTCTATCAAGATAGCTGTGAGATACAAAATTATGAATTTAAA GTATACAAAGGTATGGCCCATTCTACAGTTCCAGATGAATTAGAAGACTTGGCTTCATTT ATCAAGAAGAGCTTATCATCATAG
Protein Properties
Pfam Domain Function
Protein Residues227
Protein Molecular Weight24700.19922
Protein Theoretical pI6.88
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Acyl-protein thioesterase 1 MNGLRVAAKIQPARQTIIFLHGLGDTGSGWGFLAQYLQQRDPAAFQHTNFVFPNAPELHV TANGGALMPAWFDILEWDPSFSKVDSDGFMNSLNSIEKTVKQEIDKGIKPEQIIIGGFSQ GAALALATSVTLPWKIGGIVALSGFCSIPGILKQHKNGINVKTPIFHGHGDMDPVVPIGL GIKAKQFYQDSCEIQNYEFKVYKGMAHSTVPDELEDLASFIKKSLSS
References
External Links
ResourceLink
Saccharomyces Genome Database YLR118C
Uniprot IDQ12354
Uniprot NameAPTH1_YEAST
GenBank Gene IDAY557939
Genebank Protein ID45269770
General Reference
  • Verhasselt, P., Volckaert, G. (1997). "Sequence analysis of a 37.6 kbp cosmid clone from the right arm of Saccharomyces cerevisiae chromosome XII, carrying YAP3, HOG1, SNR6, tRNA-Arg3 and 23 new open reading frames, among which several homologies to proteins involved in cell division control and to mammalian growth factors and other animal proteins are found." Yeast 13:241-250.9090053
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Duncan, J. A., Gilman, A. G. (2002). "Characterization of Saccharomyces cerevisiae acyl-protein thioesterase 1, the enzyme responsible for G protein alpha subunit deacylation in vivo." J Biol Chem 277:31740-31752.12080046
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Baxter, S. M., Rosenblum, J. S., Knutson, S., Nelson, M. R., Montimurro, J. S., Di Gennaro, J. A., Speir, J. A., Burbaum, J. J., Fetrow, J. S. (2004). "Synergistic computational and experimental proteomics approaches for more accurate detection of active serine hydrolases in yeast." Mol Cell Proteomics 3:209-225.14645503
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356