You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial carnitine carrier
SynonymsNot Available
Gene NameCRC1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in binding
Specific FunctionTransports carnitine, acetylcarnitine, propionylcarnitine and to a much lower extent medium- and long- chain acylcarnitines
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00616(R)-CarnitineShow
YMDB00617O-acetylcarnitiniumShow
GO Classification
Component
cell part
membrane
Function
binding
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 15
LocusYOR100C
Gene Sequence>984 bp ATGTCTTCAGACACTTCATTATCAGAATCTTCATTATTGAAAGAAGAGAGTGGGAGCTTG ACCAAGTCTCGTCCACCTATAAAATCAAACCCTGTACGCGAAAATATCAAATCATTTGTG GCCGGTGGAGTTGGCGGGGTATGTGCGGTGTTTACGGGTCATCCCTTCGATTTGATTAAA GTGAGATGTCAAAATGGACAAGCGAATTCCACGGTACATGCCATTACAAATATTATAAAA GAAGCAAAAACTCAAGTAAAGGGCACATTATTTACCAATTCCGTAAAGGGGTTCTATAAA GGTGTTATCCCGCCCTTATTAGGTGTTACTCCCATATTCGCTGTTTCTTTCTGGGGTTAC GATGTGGGTAAGAAACTGGTTACTTTTAATAACAAGCAAGGAGGCAGTAACGAGTTAACT ATGGGACAAATGGCTGCAGCAGGATTTATCAGCGCTATTCCTACCACTTTAGTGACTGCG CCAACGGAAAGAGTAAAGGTTGTCCTGCAAACATCTTCTAAGGGCTCTTTCATTCAGGCG GCTAAAACCATTGTTAAAGAAGGTGGCATAGCTTCTTTATTTAAAGGTTCATTAGCCACT TTAGCAAGAGATGGGCCTGGCTCAGCTCTATATTTTGCATCTTATGAAATTTCAAAAAAT TACTTGAATAGTAGGCAACCTCGTCAAGATGCGGGCAAAGATGAACCGGTCAATATCTTG AACGTGTGTCTTGCTGGTGGTATTGCTGGTATGTCGATGTGGCTAGCTGTTTTCCCCATA GACACTATAAAGACAAAATTGCAGGCTTCCTCCACGAGGCAGAATATGCTTTCCGCCACA AAGGAAATTTATCTACAAAGAGGTGGTATCAAGGGATTTTTCCCTGGTTTAGGTCCTGCT TTACTAAGATCTTTCCCAGCCAATGCGGCCACATTTTTAGGTGTGGAGATGACTCATTCA CTGTTCAAGAAGTATGGCATATGA
Protein Properties
Pfam Domain Function
Protein Residues327
Protein Molecular Weight34753.89844
Protein Theoretical pI10.46
Signalling Regions
  • None
Transmembrane Regions
  • 33-49
  • 107-123
  • 141-162
  • 196-212
  • 244-260
  • 293-313
Protein Sequence>Mitochondrial carnitine carrier MSSDTSLSESSLLKEESGSLTKSRPPIKSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIK VRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGY DVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPTTLVTAPTERVKVVLQTSSKGSFIQA AKTIVKEGGIASLFKGSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNIL NVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTRQNMLSATKEIYLQRGGIKGFFPGLGPA LLRSFPANAATFLGVEMTHSLFKKYGI
References
External Links
ResourceLink
Saccharomyces Genome Database CRC1
Uniprot IDQ12289
Uniprot NameCRC1_YEAST
GenBank Gene IDAJ250124
Genebank Protein ID6634541
General Reference
  • Palmieri, L., Lasorsa, F. M., Iacobazzi, V., Runswick, M. J., Palmieri, F., Walker, J. E. (1999). "Identification of the mitochondrial carnitine carrier in Saccharomyces cerevisiae." FEBS Lett 462:472-476.10622748
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • van Roermund, C. W., Hettema, E. H., van den Berg, M., Tabak, H. F., Wanders, R. J. (1999). "Molecular characterization of carnitine-dependent transport of acetyl-CoA from peroxisomes to mitochondria in Saccharomyces cerevisiae and identification of a plasma membrane carnitine transporter, Agp2p." EMBO J 18:5843-5852.10545096