You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTransposon Ty1-OL Gag-Pol polyprotein
Synonyms
  • Gag-Pol-p199
  • TY1A-TY1B
  • Transposon Ty1 TYA-TYB polyprotein
  • p190
  • Capsid protein
  • CA
  • Gag-p45
  • p54
  • Ty1 protease
  • PR
  • Pol-p20
  • p23
  • Integrase
  • IN
  • Pol-p71
  • p84
  • p90
  • Reverse transcriptase/ribonuclease H
  • RT
  • RT-RH
  • Pol-p63
  • p60
Gene NameTY1B-OL
Enzyme Class
Biological Properties
General FunctionInvolved in DNA binding
Specific FunctionIntegrase (IN) targets the VLP to the nucleus, where a subparticle preintegration complex (PIC) containing at least integrase and the newly synthesized dsDNA copy of the retrotransposon must transit the nuclear membrane. Once in the nucleus, integrase performs the integration of the dsDNA into the host genome
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Purine metabolismec00230 Map00230
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00173MyoinositolShow
YMDB00219PyrophosphateShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
RNA binding
DNA binding
peptidase activity
peptidase activity, acting on L-amino acid peptides
catalytic activity
endopeptidase activity
aspartic-type endopeptidase activity
binding
hydrolase activity
nucleic acid binding
Process
protein metabolic process
metabolic process
macromolecule metabolic process
proteolysis
DNA integration
cellular macromolecule metabolic process
DNA metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYOL103W-B
Gene Sequence>5268 bp ATGGAATCCCAACAATTATCTAATTACCCACAAATTTCTCATGGTAGCGCCTGTGCTTCG GTTACTTCTAAGGAAGTCCACACAAATCAAGATCCGTTAGACGTTTCAGCTTCCAAAACA GAAGAATGTGAGAAGGCTTCCACTAAGGCTAACTCTCAACAGACAACAACACCTGCTTCA TCAGCTGTTCCAGAGAACCCCCATCATGCCTCTCCTCAACCTGCTTCAGTACCACCTCCA CAGAATGGGCCGTACCCACAGCAGTGCATGATGACCCAAAACCAAGCCAATCCATCTGGT TGGTCATTTTACGGACACCCATCTATGATTCCGTATACACCTTATCAAATGTCGCCTATG TACTTTCCACCTGGGCCACAATCACAGTTTCCGCAGTATCCATCATCAGTTGGAACGCCT CTGAGCACTCCATCACCTGAGTCAGGTAATACATTTACTGATTCATCCTCAGCGGACTCT GATATGACATCCACTAAAAAATATGTCAGACCACCACCAATGTTAACCTCACCTAATGAC TTTCCAAATTGGGTTAAAACATACATCAAATTTTTACAAAACTCGAATCTCGGTGGTATT ATTCCGACAGTAAACGGAAAACCCGTACGTCAGATCACTGATGATGAACTCACCTTCTTG TATAACACTTTTCAAATATTTGCTCCCTCTCAATTCCTACCTACCTGGGTCAAAGACATC CTATCCGTTGATTATACGGATATCATGAAAATTCTTTCCAAAAGTATTGAAAAAATGCAA TCTGATACCCAAGAGGCAAACGACATTGTGACCCTGGCAAATTTGCAATATAATGGCAGT ACACCTGCAGATGCATTTGAAACAAAAGTCACAAACATTATCAACAGACTGAACAATAAT GGCATTCATATCAATAACAAGGTCGCATGCCAATTAATTATGAGAGGTCTATCTGGCGAA TATAAATTTTTACGCTACACACGTCATCGACATCTAAATATGACAGTCGCTGAACTGTTC TTAGATATCCATGCTATTTATGAAGAACAACAGGGATCGAGAAACAGCAAACCTAATTAC AGGAGAAATCTGAGTGATGAGAAGAATGATTCTCGCAGCTATACGAATACAACCAAACCC AAAGTTATAGCTCGGAATCCTCAAAAAACAAATAATTCGAAATCGAAAACAGCCAGGGCT CACAATGTATCCACATCTAATAACTCTCCCAGCACGGACAACGATTCCATCAGTAAATCA ACTACTGAACCGATTCAATTGAACAATAAGCACGACCTTCACCTTGGCCAGGAACTTACT GAATCTACGGTAAATCACACTAATCATTCTGATGATGAACTCCCTGGACACCTCCTTCTC GATTCAGGAGCATCACGAACCCTTATAAGATCTGCTCATCACATACACTCAGCATCATCT AATCCTGACATAAACGTAGTTGATGCTCAAAAAAGAAATATACCAATTAACGCTATTGGT GACCTACAATTTCACTTCCAGGACAACACCAAAACATCAATAAAGGTATTGCACACTCCT AACATAGCCTATGACTTACTCAGTTTGAATGAATTGGCTGCAGTAGATATCACAGCATGC TTTACCAAAAACGTCTTAGAACGATCTGACGGCACTGTACTTGCACCTATCGTAAAATAT GGAGACTTTTACTGGGTATCTAAAAAGTACTTGCTTCCATCAAATATCTCCGTACCCACC ATCAATAATGTCCATACAAGTGAAAGTACACGCAAATATCCTTATCCTTTCATTCATCGA ATGCTTGCACATGCCAATGCACAGACAATTCGATACTCACTTAAAAATAACACCATCACG TATTTTAACGAATCAGATGTCGACTGGTCTAGTGCTATTGACTATCAATGTCCTGATTGT TTAATCGGCAAAAGCACCAAACACAGACATATCAAAGGTTCACGACTAAAATACCAAAAT TCATACGAACCCTTTCAATACCTACATACTGACATATTTGGTCCAGTTCACAACCTACCA AAAAGTGCACCATCCTATTTCATCTCATTTACTGATGAGACAACAAAATTCCGTTGGGTT TATCCATTACACGACCGTCGCGAGGACTCTATCCTCGATGTTTTTACTACGATACTAGCT TTTATTAAGAACCAGTTTCAGGCCAGTGTCTTGGTTATACAAATGGACCGTGGTTCTGAG TATACTAACAGAACTCTCCATAAATTCCTTGAAAAAAATGGTATAACTCCATGCTATACA ACCACAGCGGATTCCCGAGCACATGGAGTCGCTGAACGGCTCAACCGTACCTTATTAGAT GACTGCCGTACTCAACTGCAATGTAGTGGTTTACCGAACCATTTATGGTTCTCTGCAATC GAATTTTCTACTATTGTGAGAAATTCACTAGCTTCACCTAAAAGCAAAAAATCTGCAAGA CAACATGCTGGCTTGGCAGGACTTGATATCAGTACTTTGTTACCTTTCGGTCAACCTGTT ATCGTCAATGATCACAACCCTAACTCCAAAATACATCCTCGTGGCATCCCAGGCTACGCT CTACATCCGTCTCGAAACTCTTATGGATATATCATCTATCTTCCATCCTTAAAGAAGACA GTAGATACAACTAACTATGTTATTCTTCAGGGCAAGGAATCCAGATTAGATCAATTCAAT TACGACGCACTCACTTTCGATGAAGACTTAAACCGTTTAACTGCTTCATATCAATCGTTC ATTGCGTCAAATGAGATCCAACAATCCGATGATCTTAACATAGAATCTGACCATGACTTC CAATCTGACATCGAACTACATCCTGAGCAACCGAGAAATGTCCTTTCAAAAGCTGTGAGT CCAACCGATTCCACACCTCCGTCAACTCATACTGAAGATTCGAAACGTGTTTCTAAAACC AATATTCGCGCACCCAGAGAAGTTGACCCCAACATATCTGAATCTAATATTCTTCCATCA AAGAAGAGATCTAGCACCCCCCAAATTTCCAATATCGAGAGTACCGGTTCGGGTGGTATG CATAAATTAAATGTTCCTTTACTTGCTCCCATGTCCCAATCTAACACACATGAGTCGTCG CACGCCAGTAAATCTAAAGATTTCAGACACTCAGACTCGTACAGTGAAAATGAGACTAAT CATACAAACGTACCAATATCCAGTACGGGTGGTACCAACAACAAAACTGTTCCGCAGATA AGTGACCAAGAGACTGAGAAAAGGATTATACACCGTTCACCTTCAATCGATGCTTCTCCA CCGGAAAATAATTCATCGCACAATATTGTTCCTATCAAAACGCCAACTACTGTTTCTGAA CAGAATACCGAGGAATCTATCATCGCTGATCTCCCACTCCCTGATCTACCTCCAGAATCT CCTACCGAATTCCCTGACCCATTTAAAGAACTCCCACCGATAAATTCTCATCAAACTAAT TCCAGTTTGGGTGGTATTGGTGACTCTAATGCCTATACTACTATCAACAGTAAGAAAAGA TCATTAGAAGATAATGAAACTGAAATTAAGGTATCACGAGACACATGGAATACTAAGAAT ATGCGTAGTTTAGAACCTCCGAGATCGAAGAAACGAATTCACCTGATTGCAGCTGTAAAA GCAGTAAAATCAATCAAACCAATACGGACAACCTTACGATACGATGAGGCAATCACCTAT AATAAAGATATTAAAGAAAAAGAAAAATATATCGAGGCATACCACAAAGAAGTCAATCAA CTGTTGAAGATGAAAACTTGGGACACTGACGAATATTATGACAGAAAAGAAATAGACCCT AAAAGAGTAATAAACTCAATGTTTATCTTCAACAAGAAACGTGACGGTACTCATAAAGCT AGATTTGTTGCAAGAGGTGATATTCAGCATCCTGACACTTACGACTCAGGCATGCAATCC AATACCGTACATCACTATGCATTAATGACATCCCTGTCACTTGCATTAGACAATAACTAC TATATTACACAATTAGACATATCTTCGGCATATTTGTATGCAGACATCAAAGAAGAATTA TACATAAGACCTCCACCACATTTAGGAATGAATGATAAGTTGATACGTTTGAAGAAATCA CTTTATGGATTGAAACAAAGTGGAGCGAACTGGTACGAAACTATCAAATCATACCTGATA AAACAGTGTGGTATGGAAGAAGTTCGTGGATGGTCATGCGTATTTAAGAATAGTCAAGTA ACAATATGTTTATTTGTTGACGACATGATTTTATTCAGCAAAGACTTAAATGCAAATAAG AAAATCATAACAACACTCAAGAAACAATACGATACAAAGATAATAAATCTGGGTGAAAGT GATAACGAAATTCAGTACGACATACTTGGCTTAGAAATCAAATATCAAAGAGGTAAATAC ATGAAATTAGGTATGGAAAACTCATTAACTGAGAAAATACCCAAATTAAACGTACCTTTG AATCCAAAAGGAAGAAAACTTAGCGCTCCAGGTCAACCAGGTCTTTATATAGACCAGGAT GAACTAGAAATAGATGAAGATGAATACAAAGAGAAGGTACATGAAATGCAAAAGTTGATT GGTCTAGCTTCATATGTTGGATATAAATTTAGATTTGACTTACTATACTACATCAACACA CTTGCTCAACATATACTATTCCCCTCTAGGCAAGTTTTAGACATGACATATGAGTTGATA CAATTCATGTGGGACACTAGAGATAAACAACTGATATGGCACAAAAACAAACCTACCGAG CCAGATAATAAACTAGTCGCAATAAGTGATGCTTCGTATGGCAACCAACCGTATTATAAA TCACAAATTGGCAACATATATTTACTTAATGGAAAGGTAATTGGAGGAAAGTCCACCAAG GCTTCATTAACATGTACTTCAACTACGGAAGCAGAAATACACGCGATAAGTGAATCTGTC CCATTATTAAATAATCTAAGTTACCTGATACAAGAACTTAACAAGAAACCAATTATTAAA GGCTTACTTACTGATAGTAGATCAACGATCAGTATAATTAAGTCTACAAATGAAGAGAAA TTTAGAAACAGATTTTTTGGCACAAAGGCAATGAGACTTAGAGATGAAGTATCAGGTAAT AATTTATACGTATACTACATCGAGACCAAGAAGAACATTGCTGATGTGATGACAAAACCT CTTCCGATAAAAACATTCAAACTATTAACAAACAAATGGATTCATTAG
Protein Properties
Pfam Domain Function
Protein Residues1755
Protein Molecular Weight198613.0
Protein Theoretical pI8.27
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Transposon Ty1-OL Gag-Pol polyprotein MESQQLSNYPQISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPAS SAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND FPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDI LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIINRLNNN GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY RRNLSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS TTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTLIRSAHHIHSASS NPDINVVDAQKRNIPINAIGDLQFHFQDNTKTSIKVLHTPNIAYDLLSLNELAAVDITAC FTKNVLERSDGTVLAPIVKYGDFYWVSKKYLLPSNISVPTINNVHTSESTRKYPYPFIHR MLAHANAQTIRYSLKNNTITYFNESDVDWSSAIDYQCPDCLIGKSTKHRHIKGSRLKYQN SYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTKFRWVYPLHDRREDSILDVFTTILA FIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGITPCYTTTADSRAHGVAERLNRTLLD DCRTQLQCSGLPNHLWFSAIEFSTIVRNSLASPKSKKSARQHAGLAGLDISTLLPFGQPV IVNDHNPNSKIHPRGIPGYALHPSRNSYGYIIYLPSLKKTVDTTNYVILQGKESRLDQFN YDALTFDEDLNRLTASYQSFIASNEIQQSDDLNIESDHDFQSDIELHPEQPRNVLSKAVS PTDSTPPSTHTEDSKRVSKTNIRAPREVDPNISESNILPSKKRSSTPQISNIESTGSGGM HKLNVPLLAPMSQSNTHESSHASKSKDFRHSDSYSENETNHTNVPISSTGGTNNKTVPQI SDQETEKRIIHRSPSIDASPPENNSSHNIVPIKTPTTVSEQNTEESIIADLPLPDLPPES PTEFPDPFKELPPINSHQTNSSLGGIGDSNAYTTINSKKRSLEDNETEIKVSRDTWNTKN MRSLEPPRSKKRIHLIAAVKAVKSIKPIRTTLRYDEAITYNKDIKEKEKYIEAYHKEVNQ LLKMKTWDTDEYYDRKEIDPKRVINSMFIFNKKRDGTHKARFVARGDIQHPDTYDSGMQS NTVHHYALMTSLSLALDNNYYITQLDISSAYLYADIKEELYIRPPPHLGMNDKLIRLKKS LYGLKQSGANWYETIKSYLIKQCGMEEVRGWSCVFKNSQVTICLFVDDMILFSKDLNANK KIITTLKKQYDTKIINLGESDNEIQYDILGLEIKYQRGKYMKLGMENSLTEKIPKLNVPL NPKGRKLSAPGQPGLYIDQDELEIDEDEYKEKVHEMQKLIGLASYVGYKFRFDLLYYINT LAQHILFPSRQVLDMTYELIQFMWDTRDKQLIWHKNKPTEPDNKLVAISDASYGNQPYYK SQIGNIYLLNGKVIGGKSTKASLTCTSTTEAEIHAISESVPLLNNLSYLIQELNKKPIIK GLLTDSRSTISIIKSTNEEKFRNRFFGTKAMRLRDEVSGNNLYVYYIETKKNIADVMTKP LPIKTFKLLTNKWIH
References
External Links
ResourceLink
Saccharomyces Genome Database TY1B-OL
Uniprot IDQ12273
Uniprot NameYO11B_YEAST
GenBank Gene IDZ74845
Genebank Protein ID1419960
General Reference
  • Vandenbol, M., Durand, P., Portetelle, D., Hilger, F. (1995). "Sequence analysis of a 44 kb DNA fragment of yeast chromosome XV including the Tyl-H3 retrotransposon, the suf1(+) frameshift suppressor gene for tRNA-Gly, the yeast transfer RNA-Thr-1a and a delta element." Yeast 11:1069-1075.7502582
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Kim, J. M., Vanguri, S., Boeke, J. D., Gabriel, A., Voytas, D. F. (1998). "Transposable elements and genome organization: a comprehensive survey of retrotransposons revealed by the complete Saccharomyces cerevisiae genome sequence." Genome Res 8:464-478.9582191
  • Lesage, P., Todeschini, A. L. (2005). "Happy together: the life and times of Ty retrotransposons and their hosts." Cytogenet Genome Res 110:70-90.16093660
  • Wilhelm, F. X., Wilhelm, M., Gabriel, A. (2005). "Reverse transcriptase and integrase of the Saccharomyces cerevisiae Ty1 element." Cytogenet Genome Res 110:269-287.16093680