You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInositol-1,4,5-trisphosphate 5-phosphatase 3
Synonyms
  • Suppressor of PMA1 protein 2
  • Synaptojanin-like protein 3
Gene NameINP53
Enzyme Class
Biological Properties
General FunctionInvolved in inositol or phosphatidylinositol phosphatase activity
Specific FunctionControls the cellular levels and subcellular distribution of phosphatidylinositol 3-phosphate and phosphatidylinositol 4,5-bisphosphate. Plays an essential role in a TGN (trans Golgi network)-to-early endosome pathway. Involved in clathrin-mediated protein sorting at the TGN
Cellular LocationCytoplasm.
SMPDB Pathways
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB ReactionsNot Available
KEGG Reactions
water + 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphate ↔ phosphate + 1-phosphatidyl-1D-myo-inositol 3-phosphate + hydron
1-phosphatidyl-1D-myo-inositol 3-phosphate + waterphosphate + 1-Phosphatidyl-D-myo-inositol + hydron
water + 1D-myo-inositol 4,5-bisphosphatephosphate + 1-phosphatidyl-1D-myo-inositol 4-phosphate + hydron
water + 1D-myo-inositol 4,5-bisphosphatephosphate + 1-phosphatidyl-1D-myo-inositol 4-phosphate + hydron
1-phosphatidyl-1D-myo-inositol 4-phosphate + waterphosphate + 1-Phosphatidyl-D-myo-inositol + hydron
Metabolites
YMDB IDNameView
YMDB00291Inositol 1,4,5-trisphosphateShow
YMDB008521D-myo-inositol 1,4-bisphosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
inositol or phosphatidylinositol phosphatase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 15
LocusYOR109W
Gene Sequence>3324 bp ATGATTATCTTTGTTTCAGAAGAACCTGAAAGGAGGCTAGCCATTGTATCCAACTTGTAT GCTCTTGTTCTTAAACCGGTTGGGAAAAAGCCATCTGATAAACCCCTTTGTGCCATTGAA CTTCTTCAAAAAAATGATTTGAAAAAATATGGCTTCAAAAGACTTACATCACACGAAATT TTTGGTGTTATCGGACTCATTGAGGTTAATGGCCTGCTGTTTGTTGGTGCCATCACTGGG AAATCAAAAGTTGCACAGCCATGCCCAGGAGAGACTGTGAACAAAATTTTTGCTGTCGAT TTTTTTTGTTTAAATGACAACAGTTGGGATTTTATTGAAATCGACTCCTCAGGTTATCCT GTGTTGCCGGAGACTGCTTCAACTGAATATCAAGACGCCTTGCCAAAACATCCATGCTAT GAATTGAAGAAACTATTATCCAATGGATCTTTTTATTATAGTTCAGATTTTGATTTGACC TCAACCTTACAGCATCGTGGATATGGTCAGCATTCTTTGAGTACAGATACCTACGAAGAA GAATATATGTGGAACTCTTTTCTCATGCAAGAAATGATCACATACAGAGATCATTTGGAC ACAAATTTGAAACAAATCTTGGATGACGAGGGGTTTTTAACAACAGTTATCCGTGGATTT GCGGAAACTTTCGTCTCGTACGTTAAGAAGTTGAAAGTTGCTCTTACTATCATCTCGAAA CAGAGCTGGAAAAGAGCAGGAACAAGATTTAATGCACGTGGTGTGGATGATGAGGCAAAC GTTGCCAATTTCGTAGAAACGGAATTCATTATGTATTCTAGCCAATACTGTTATGCTTTT ACACAGATTAGAGGCAGTATACCTGTATTCTGGGAGCAAGGTACCTCTTTAATCAATCCA AGAGTACAAATTACAAGATCATTTGAAGCCACCCAACCGGTATTTGACAAACATATCATG AAATCAGTGGAAAAGTACGGACCTGTGCATGTCGTTAATTTGTTATCAACGAAATCTTCT GAAATTGAACTTTCAAAACGATACAAGGAGCATTTAACTCATTCAAAAAAATTGAACTTC AACAAAGATATATTTTTGACAGAATTCGATTTTCATAAAGAAACTTCGCAAGAAGGCTTT TCCGGTGTCAGAAAACTCATTCCATTAATATTGGACTCTCTTTTATCTTCTGGCTATTAT TCTTACGATGTTAGAGAAAAAAAGAACATATCTGAACAACATGGCATATTTAGGACCAAC TGTTTAGATTGTTTGGATAGAACAAATTTAGCTCAGCAAATTATTTCTTTGGCTGCTTTT AGAACTTTTCTCGAAGATTTCCGATTGATTAGTTCAAATTCGTTCATCGACGATGATGAT TTCGTTTCTAAACATAACACCCTGTGGGCTGATCACGGTGATCAAATTTCCCAAATATAT ACTGGTACTAATGCTTTGAAGTCCTCATTTTCAAGAAAAGGTAAAATGTCACTTGCTGGG GCATTATCAGACGCCACAAAATCGGTCAGCAGAATATATATTAACAATTTCATGGATAAA GAAAAGCAACAAAATATCGATACTTTGTTGGGAAGGTTACCGTATCAGAAAGCAGTGCAA CTTTATGATCCCGTAAACGAATACGTAAGTACGAAATTACAAAGCATGTCTGATAAGTTC ACATCAACCTCCAACATTAACTTGTTAATAGGATCATTCAATGTTAATGGCGCAACCAAA AAAGTTGATTTATCAAAGTGGTTATTTCCAATCGGTGAAAAATTTAAACCCGATATTGTT GTTTTAGGTCTTCAAGAAGTTATAGAACTATCTGCGGGTTCGATTTTGAACGCTGATTAC TCGAAAAGCTCTTTCTGGGAAAACTTAGTGGGTGATTGCTTAAACCAGTATGATGATAAA TATCTGTTGTTAAGAGTAGAGCAAATGACTTCTTTACTAATTTTATTTTTTGTTAAAGCA GACAAAGCTAAATACGTCAAACAAGTGGAGGGTGCTACTAAAAAAACTGGCTTTAGGGGT ATGGCTGGGAATAAAGGTGCAGTGTCTATAAGATTTGAGTACGGTGCCACTTCATTTTGT TTTGTCAATTCTCATCTCGCAGCAGGAGCTACGAATGTCGAAGAACGTCGAAGTGATTAC GAGAGCATAGTTAGAGGTATTACTTTCACTAGAACTAAGATGATTCCTCATCACGATTCG ATTTTCTGGTTAGGTGACATGAATTATAGAATAAATCTACCGAACGAAGACGTCAGAAGA GAGTTGCTCAACCAAGAAGAAGGATATATCGATAAACTGTTGCATTTTGATCAACTTACC CTAGGTATTAATTCTGGCAGTGTATTTGAAGGCTTCAAAGAACCAACTCTCAAGTTCCGT CCAACATACAAGTATGATCCCGGGACAGGAACTTATGATTCTTCTGAAAAGGAAAGGACG CCGTCATGGACAGATAGAATTATTTATAAAGGGGAAAACTTACTTCCTTTATCTTATTCA GATGCTCCGATAATGATTAGCGACCATCGGCCAGTTTACGCAGCATATAGAGCAAAAATA ACTTTTGTTGATGATAAAGAGAGACTATCTCTCAAGAAACGTTTATTCACAGAATACAAA CAAGAGCATCCCGAAGAACCGGGTTCTCTGATATCGGATCTTCTCAGCCTTGATCTGGAT AATAAGAGCACTGATGGATTCAAAAGCTCTTCTGAAAGTTCTCTACTTGATATTGATCCG ATAATGGCACAACCGACAGCGTCCAGCGTTGCTTCTTCGTCACCTGTGTCTTCAGCATCG GCTTCACTACAACCTGTCAGAACTCAAAACAGTAGCCAGTCGCGTACCCCCATAAAGAAA CCGGTATTGCGCCCCCCACCCCCACCTGCTCATAAATCTGTATCAGCACCTGCTCCTTCA ACATCGAAGGAAAAATCACCAACACCACAGACCTCAACTGCATCGTTGTCATCTGTGACT AAAAATATACAGGAAAATAAACCATTGGCGCAAAATAGACGAATTCCACCACCAGGTTTT AGTCAAAATATATTAACTCCAAAAAGTACCAGTAACTTGGCTTCGCCTATGTCTTCTAAG GTTGATTTATATAATAGCGCGAGTGAATCTACACGTTCAGCCCAAGATGCAAGACAACAG ACACCTACAGCATTTGCAGCATCAAGAGACGTCAATGGGCAGCCCGAAGCTTTGCTAGGT GATGAAAATCCAATTGAGCCAGAGGAAAAGGCCAAACTAAACCATATGACTTTAGACTCA TGGCAGCCATTGACCCCAAAATGA
Protein Properties
Pfam Domain Function
Protein Residues1107
Protein Molecular Weight124576.0
Protein Theoretical pI7.2
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inositol-1,4,5-trisphosphate 5-phosphatase 3 MIIFVSEEPERRLAIVSNLYALVLKPVGKKPSDKPLCAIELLQKNDLKKYGFKRLTSHEI FGVIGLIEVNGLLFVGAITGKSKVAQPCPGETVNKIFAVDFFCLNDNSWDFIEIDSSGYP VLPETASTEYQDALPKHPCYELKKLLSNGSFYYSSDFDLTSTLQHRGYGQHSLSTDTYEE EYMWNSFLMQEMITYRDHLDTNLKQILDDEGFLTTVIRGFAETFVSYVKKLKVALTIISK QSWKRAGTRFNARGVDDEANVANFVETEFIMYSSQYCYAFTQIRGSIPVFWEQGTSLINP RVQITRSFEATQPVFDKHIMKSVEKYGPVHVVNLLSTKSSEIELSKRYKEHLTHSKKLNF NKDIFLTEFDFHKETSQEGFSGVRKLIPLILDSLLSSGYYSYDVREKKNISEQHGIFRTN CLDCLDRTNLAQQIISLAAFRTFLEDFRLISSNSFIDDDDFVSKHNTLWADHGDQISQIY TGTNALKSSFSRKGKMSLAGALSDATKSVSRIYINNFMDKEKQQNIDTLLGRLPYQKAVQ LYDPVNEYVSTKLQSMSDKFTSTSNINLLIGSFNVNGATKKVDLSKWLFPIGEKFKPDIV VLGLQEVIELSAGSILNADYSKSSFWENLVGDCLNQYDDKYLLLRVEQMTSLLILFFVKA DKAKYVKQVEGATKKTGFRGMAGNKGAVSIRFEYGATSFCFVNSHLAAGATNVEERRSDY ESIVRGITFTRTKMIPHHDSIFWLGDMNYRINLPNEDVRRELLNQEEGYIDKLLHFDQLT LGINSGSVFEGFKEPTLKFRPTYKYDPGTGTYDSSEKERTPSWTDRIIYKGENLLPLSYS DAPIMISDHRPVYAAYRAKITFVDDKERLSLKKRLFTEYKQEHPEEPGSLISDLLSLDLD NKSTDGFKSSSESSLLDIDPIMAQPTASSVASSSPVSSASASLQPVRTQNSSQSRTPIKK PVLRPPPPPAHKSVSAPAPSTSKEKSPTPQTSTASLSSVTKNIQENKPLAQNRRIPPPGF SQNILTPKSTSNLASPMSSKVDLYNSASESTRSAQDARQQTPTAFAASRDVNGQPEALLG DENPIEPEEKAKLNHMTLDSWQPLTPK
References
External Links
ResourceLink
Saccharomyces Genome Database INP53
Uniprot IDQ12271
Uniprot NameINP53_YEAST
GenBank Gene IDX94335
Genebank Protein ID1164954
General Reference
  • Whisstock, J. C., Romero, S., Gurung, R., Nandurkar, H., Ooms, L. M., Bottomley, S. P., Mitchell, C. A. (2000). "The inositol polyphosphate 5-phosphatases and the apurinic/apyrimidinic base excision repair endonucleases share a common mechanism for catalysis." J Biol Chem 275:37055-37061.10962003
  • Ha, S. A., Torabinejad, J., DeWald, D. B., Wenk, M. R., Lucast, L., De Camilli, P., Newitt, R. A., Aebersold, R., Nothwehr, S. F. (2003). "The synaptojanin-like protein Inp53/Sjl3 functions with clathrin in a yeast TGN-to-endosome pathway distinct from the GGA protein-dependent pathway." Mol Biol Cell 14:1319-1333.12686590
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Nguyen, P. H., Hasek, J., Kohlwein, S. D., Romero, C., Choi, J. H., Vancura, A. (2005). "Interaction of Pik1p and Sjl proteins in membrane trafficking." FEMS Yeast Res 5:363-371.15691741
  • Bensen, E. S., Costaguta, G., Payne, G. S. (2000). "Synthetic genetic interactions with temperature-sensitive clathrin in Saccharomyces cerevisiae. Roles for synaptojanin-like Inp53p and dynamin-related Vps1p in clathrin-dependent protein sorting at the trans-Golgi network." Genetics 154:83-97.10628971
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Guo, S., Stolz, L. E., Lemrow, S. M., York, J. D. (1999). "SAC1-like domains of yeast SAC1, INP52, and INP53 and of human synaptojanin encode polyphosphoinositide phosphatases." J Biol Chem 274:12990-12995.10224048
  • Parrish, W. R., Stefan, C. J., Emr, S. D. (2004). "Essential role for the myotubularin-related phosphatase Ymr1p and the synaptojanin-like phosphatases Sjl2p and Sjl3p in regulation of phosphatidylinositol 3-phosphate in yeast." Mol Biol Cell 15:3567-3579.15169871
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Singer-Kruger, B., Nemoto, Y., Daniell, L., Ferro-Novick, S., De Camilli, P. (1998). "Synaptojanin family members are implicated in endocytic membrane traffic in yeast." J Cell Sci 111 ( Pt 22):3347-3356.9788876
  • Hughes, W. E., Woscholski, R., Cooke, F. T., Patrick, R. S., Dove, S. K., McDonald, N. Q., Parker, P. J. (2000). "SAC1 encodes a regulated lipid phosphoinositide phosphatase, defects in which can be suppressed by the homologous Inp52p and Inp53p phosphatases." J Biol Chem 275:801-808.10625610
  • Ooms, L. M., McColl, B. K., Wiradjaja, F., Wijayaratnam, A. P., Gleeson, P., Gething, M. J., Sambrook, J., Mitchell, C. A. (2000). "The yeast inositol polyphosphate 5-phosphatases inp52p and inp53p translocate to actin patches following hyperosmotic stress: mechanism for regulating phosphatidylinositol 4,5-bisphosphate at plasma membrane invaginations." Mol Cell Biol 20:9376-9390.11094088
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Luo, W., Chang, A. (1997). "Novel genes involved in endosomal traffic in yeast revealed by suppression of a targeting-defective plasma membrane ATPase mutant." J Cell Biol 138:731-746.9265642
  • Wicky, S., Frischmuth, S., Singer-Kruger, B. (2003). "Bsp1p/Ypr171p is an adapter that directly links some synaptojanin family members to the cortical actin cytoskeleton in yeast." FEBS Lett 537:35-41.12606027
  • Saiz, J. E., Santos, M. A., Vazquez de Aldana, C. R., Revuelta, J. L. (1999). "Disruption of six unknown open reading frames from Saccharomyces cerevisiae reveals two genes involved in vacuolar morphogenesis and one gene required for sporulation." Yeast 15:155-164.10029994
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Ha, S. A., Bunch, J. T., Hama, H., DeWald, D. B., Nothwehr, S. F. (2001). "A novel mechanism for localizing membrane proteins to yeast trans-Golgi network requires function of synaptojanin-like protein." Mol Biol Cell 12:3175-3190.11598201
  • Stolz, L. E., Huynh, C. V., Thorner, J., York, J. D. (1998). "Identification and characterization of an essential family of inositol polyphosphate 5-phosphatases (INP51, INP52 and INP53 gene products) in the yeast Saccharomyces cerevisiae." Genetics 148:1715-1729.9560389
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950