You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRibose-phosphate pyrophosphokinase 5
Synonyms
  • Phosphoribosyl pyrophosphate synthase 5
Gene NamePRS5
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific Function5-phosphoribose 1-diphosphate synthase involved in nucleotide, histidine, and tryptophan biosynthesis. Active in heteromultimeric complexes with other 5-phosphoribose 1- diphosphate synthases (PRS2, PRS3, PRS4 and PRS5)
Cellular LocationCytoplasm
SMPDB Pathways
Histidine BiosynthesisPW002418 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose phosphate pathwayec00030 Map00030
Purine metabolismec00230 Map00230
SMPDB Reactions
D-Ribose 5-phosphate + Adenosine triphosphateAdenosine monophosphate + hydron + Phosphoribosyl pyrophosphate
KEGG Reactions
Adenosine triphosphate + alpha-D-ribose 5-phosphateAdenosine monophosphate + hydron + Phosphoribosyl pyrophosphate
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00119D-Ribose 5-phosphateShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00650alpha-D-ribose 5-phosphateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
diphosphotransferase activity
ribose phosphate diphosphokinase activity
binding
ion binding
cation binding
metal ion binding
catalytic activity
transferase activity
magnesium ion binding
Process
metabolic process
cellular biosynthetic process
nucleoside monophosphate metabolic process
nitrogen compound metabolic process
nucleoside monophosphate biosynthetic process
cellular nitrogen compound metabolic process
nucleotide biosynthetic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
ribonucleoside monophosphate biosynthetic process
nucleotide metabolic process
biosynthetic process
nucleoside metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOL061W
Gene Sequence>1491 bp ATGTCAATGAGTAATATTGTTGTTTTTGGAGGGGACTCGCACCCCGAGTTAGTTACTAAG ATCTGTGAAAATTTGGACATTCACCCATCGAAAGTAGAATTAGGGAAGTTTTCTAATGGG GAAACGAACATTGCTCTTCGCGAATCTGTTCGTGAAAAGGATGTATATATCATCCAGAGT GGTTGTGGCCAGGTGAACGACACGTTCATGCAGTTGCTGATTTTAATCAGTGCCTGCAAG TCCGCTTCTGCCTCGAGGGTTACAGCCGTAATGCCATATCTCTGCTACTCGAGACAGCCA GATATTCCATATACTGCCAAGGGTGCTCCCATAATTTCCAAGCCTAAAGAAAACTATACT TTTGAATCGCATCCAGGCACACCCGTGTCATCTTCTTTAATGACGCAAAGACCAGGTGCT GAGAGCTCGTTGAAGAGTTTGGATAGTGCAATACGATCAACTATCAACTTAGAAAATCCT CAACCTATCAGAACACCAAACAGCAGTGCTACGGCGAATAACAATTTCGACATCAAGAAG ACGCTTTCTTTTTCAAGAATTCCTATGATTCCCGGTGGTAAGTTACAAAATACAAGCAAT AGCACGGACGCTGGTGAATTGTTCAACGCTCAAAATGCAGGCTATAAGCTATGGGTAGTA CAAGCCGGTACTTTGATTGCTCATTTGTTGAGTGCTGCAGGTGCTGACCATGTGATCACA ATGGATTTGCACGATCCACAGTTCCCTGGGTTTTTTGACATTCCAGTGGATAATCTCTAC TGTAAACCCATTGCACAAAACTACATCCAGCATCGCATTCCAGATTATCAGGATGCTGTG ATCGTTTCTCCAGATGCTGGTGGTGCAAAGAGAGCTACGGCTATTGCAGACGCCTTGGAA TTGTCCTTCGCCCTAATTCATAAAGAAAGAAGATCTCAGTTATTGAAGGGCCCTCCAGAT GCGACGTTAACCTCTGGTGGTTCGTTACCAGTATCTCCAAGGCCATTAGTTACTACTTTG GTTTCCTCCCAAAATACTACTTCTTCAGGTGCCACTGGGGTTGCGGCCCTTGAAATGAAG AAAACAACTTCAACATCTTCCACCTCGTCGCAATCTTCTAATTCGTCCAAGTTCGTTCAA ACTACCATGCTTGTTGGCGATGTTAGAAACAAGGTGTGTATTATAGTCGACGACTTGGTG GATACTTCATACACTATTACAAGAGCTGCGAAATTGTTGAAGGATCAAGGATCTACCAAA GTTTATGCCTTAATAACGCACGGTGTTTTTTCCGGTGATGCGCTAGAAAGAATCGGCCAA AGTAGTATAGATAAGTTGATCATTTCTAACACGGTTCCTCAAGATAGAACACTACAGTAC CTAGGTAAGGACAGAGTGGATGTTATTGATGTCTCCTGCATAATCGGTGAAGCAATTAGA AGAATCCATAACGGTGAATCCATTTCTATGTTGTTCGAGCATGGATGGTAG
Protein Properties
Pfam Domain Function
Protein Residues496
Protein Molecular Weight53504.19922
Protein Theoretical pI7.31
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ribose-phosphate pyrophosphokinase 5 MSMSNIVVFGGDSHPELVTKICENLDIHPSKVELGKFSNGETNIALRESVREKDVYIIQS GCGQVNDTFMQLLILISACKSASASRVTAVMPYLCYSRQPDIPYTAKGAPIISKPKENYT FESHPGTPVSSSLMTQRPGAESSLKSLDSAIRSTINLENPQPIRTPNSSATANNNFDIKK TLSFSRIPMIPGGKLQNTSNSTDAGELFNAQNAGYKLWVVQAGTLIAHLLSAAGADHVIT MDLHDPQFPGFFDIPVDNLYCKPIAQNYIQHRIPDYQDAVIVSPDAGGAKRATAIADALE LSFALIHKERRSQLLKGPPDATLTSGGSLPVSPRPLVTTLVSSQNTTSSGATGVAALEMK KTTSTSSTSSQSSNSSKFVQTTMLVGDVRNKVCIIVDDLVDTSYTITRAAKLLKDQGSTK VYALITHGVFSGDALERIGQSSIDKLIISNTVPQDRTLQYLGKDRVDVIDVSCIIGEAIR RIHNGESISMLFEHGW
References
External Links
ResourceLink
Saccharomyces Genome Database PRS5
Uniprot IDQ12265
Uniprot NameKPR5_YEAST
GenBank Gene IDX91067
Genebank Protein ID984179
General Reference
  • Mannhaupt, G., Vetter, I., Schwarzlose, C., Mitzel, S., Feldmann, H. (1996). "Analysis of a 26 kb region on the left arm of yeast chromosome XV." Yeast 12:67-76.8789261
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hernando, Y., Parr, A., Schweizer, M. (1998). "PRS5, the fifth member of the phosphoribosyl pyrophosphate synthetase gene family in Saccharomyces cerevisiae, is essential for cell viability in the absence of either PRS1 or PRS3." J Bacteriol 180:6404-6407.9829955
  • Hernando, Y., Carter, A. T., Parr, A., Hove-Jensen, B., Schweizer, M. (1999). "Genetic analysis and enzyme activity suggest the existence of more than one minimal functional unit capable of synthesizing phosphoribosyl pyrophosphate in Saccharomyces cerevisiae." J Biol Chem 274:12480-12487.10212224
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Hove-Jensen, B. (2004). "Heterooligomeric phosphoribosyl diphosphate synthase of Saccharomyces cerevisiae: combinatorial expression of the five PRS genes in Escherichia coli." J Biol Chem 279:40345-40350.15280369
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956