You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePolyamine transporter 4
SynonymsNot Available
Gene NameTPO4
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transport
Specific FunctionCell membrane polyamine/proton antiporter, involved in the detoxification of excess polyamines in the cytoplasm. Recognizes spermidine, spermine and the antimalarial drug quinidine, but not quinine, chloroquine and mefloquine
Cellular LocationCell membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00132PutrescineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
Function
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 15
LocusYOR273C
Gene Sequence>1980 bp ATGCCTTCTTCTTTGACAAAAACCGAATCTAACTCAGATCCTCGAACAAACATACAGCAG GTACCAAAAGCCTTGGACAAAAATGTAACTAATAGCGGCAACTTGGATTCGACTTCTTCT TCGACAGGGTCAATAACAGAGGACGAAAAAAGATCAGAACCGAATGCAGATTCCAATAAC ATGACAGGGGGCGAGCCAATTGACCCAAGAGATCTCGATTGGGACGGGCCCGATGACCCA GACAATCCGCATAATTGGTCCTCTTTGAAGAAATGGTATACTACTATGACTTCAGCTTTT CTTTGTTTGGTCGTCACAATGGGTAGTTCCCTATATGTTTCTTCCGTACCAGAATTGGTA GAAAGATATCACGTTAGTCAGACTTTGGCGCTTGCTGGTTTAACTTTCTATCTTCTGGGT TTATCGACTGTCATCGGCGCTCCATTAAGTGAAGTGTTTGGTCGTAAGCCTGTCTATTTA TTTTCCCTACCTGTGTCAATGCTTTTCACCATGGGTGTTGGGTTATCCAATGGCCACATG AGAATAATTCTACCCCTAAGGTTTTTATCAGGTGTCTTTGCATCCCCCGCCTTATCCGTT GGATCAGGTACCATCCTGGATATCTTTGACGTGGACCAGGTCTCCGTCGCAATGACATAC TTTGTTCTATCTCCATTCTTAGGGCCAGTTTTATCTCCTATTATGGCAGGATTTGCTACT GAAGCCAAAGGCTGGCGTTGGTCTGAATGGATCCAATTGATTGCGGGCGGTCTAATCTTG CCATTTATTGCGCTCATGCCAGAGACCCATAAAGGTATTATTTTAAGAAAGCGTGCCAAG AAGAGAAATATAGCCTTGAAGAAGTTCAGCAGGGAAGCTCAGAAAGAATTTTTAAAAACC ACTGTCACTATTACAATCTTAAGGCCTTTAAAAATGCTTGTCGTTGAACCTATTGTATTT GTTTTCAGTGTTTATGTCGCTTTCATATTCGCCATTTTATTTGGATTTTTCGAAGCATAC GCTGTCATTTATCGTGGTGTTTACCACATGTCTATGGGGATATCTGGCTTGCCATTTATT GGTATTGGTGTCGGGTTATGGATAGGTGCTTTCTTTTACCTTTACATCGACAGAAAATAT CTCTTCCCTAAACCACCAGCTGGCACTCAACCACTCACCGAAAAAGAGAGAACTTCTAAA AGGACTACCCCTTACAGAGGTGCAAGAGACGCTGAAACAGGTGAATTGCTACCCGTTGTT CCAGAAAAATTTTTAATTGCCTGTAAATTTGGTTCTGTAGCTTTGCCTATCGGCCTGTTT TGGCAAGCCTGGACTGCTAGATCAGATGTCCACTGGATGGCTCCTGTGGCTGCCGGTGTG CCATTTGGTTTTGGTTTAATTTTGATTTTTTTCAGCGTTTTAATGTACTTCTCTACATGC TATCCGCCATTAACTGTGGCATCCTGTTTGGCTGCCAATAATCTATTAAGATACGTTATG AGTAGTGTATTCCCATTGTTTACCATCCAAATGTACACAAAGATGAAAATCAAATGGGCA AGCACTTTATTTGCATTAGTTTGCGTTGTGATGATTCCAATTCCATGGGTTTTTGAAAAA TGGGGGAGCAAATTAAGACACAAGTCACAATTTGGTTATGCCGCCATGGAAAAGGAGGCT GAGACCGAAGGTGGTATAGATGACGTAAATGCTGTCGATGGTGAATTGAATCTAACAAGG ATGACCACGTTAAGGACCATGGAAACAGACCCTTCGACTAGAGAAAAACCAGGTGAAAGG CTATCTCTGCGCAGGACCCATACGCAGCCCGTTCCTGCCTCGTTTGATCGCGAGGACGGG CAACATGCGCAAAATCGTAATGAACCCATTTCCAATAGTTTATACTCAGCTATCAAGGAT AATGAAGACGGTTATTCGTATACGGAAATGGCCACCGATGCTTCCGCCAGAATGGTTTGA
Protein Properties
Pfam Domain Function
Protein Residues659
Protein Molecular Weight73222.20313
Protein Theoretical pI8.39
Signalling Regions
  • None
Transmembrane Regions
  • 100-120
  • 129-149
  • 158-178
  • 188-208
  • 216-236
  • 247-267
  • 317-337
  • 356-376
  • 424-444
  • 457-477
  • 487-509
  • 519-539
Protein Sequence>Polyamine transporter 4 MPSSLTKTESNSDPRTNIQQVPKALDKNVTNSGNLDSTSSSTGSITEDEKRSEPNADSNN MTGGEPIDPRDLDWDGPDDPDNPHNWSSLKKWYTTMTSAFLCLVVTMGSSLYVSSVPELV ERYHVSQTLALAGLTFYLLGLSTVIGAPLSEVFGRKPVYLFSLPVSMLFTMGVGLSNGHM RIILPLRFLSGVFASPALSVGSGTILDIFDVDQVSVAMTYFVLSPFLGPVLSPIMAGFAT EAKGWRWSEWIQLIAGGLILPFIALMPETHKGIILRKRAKKRNIALKKFSREAQKEFLKT TVTITILRPLKMLVVEPIVFVFSVYVAFIFAILFGFFEAYAVIYRGVYHMSMGISGLPFI GIGVGLWIGAFFYLYIDRKYLFPKPPAGTQPLTEKERTSKRTTPYRGARDAETGELLPVV PEKFLIACKFGSVALPIGLFWQAWTARSDVHWMAPVAAGVPFGFGLILIFFSVLMYFSTC YPPLTVASCLAANNLLRYVMSSVFPLFTIQMYTKMKIKWASTLFALVCVVMIPIPWVFEK WGSKLRHKSQFGYAAMEKEAETEGGIDDVNAVDGELNLTRMTTLRTMETDPSTREKPGER LSLRRTHTQPVPASFDREDGQHAQNRNEPISNSLYSAIKDNEDGYSYTEMATDASARMV
References
External Links
ResourceLink
Saccharomyces Genome Database TPO4
Uniprot IDQ12256
Uniprot NameTPO4_YEAST
GenBank Gene IDX89633
Genebank Protein ID1279700
General Reference
  • Cheret, G., Bernardi, A., Sor, F. (1996). "DNA sequence analysis of the VPH1-SNF2 region on chromosome XV of Saccharomyces cerevisiae." Yeast 12:1059-1064.8896271
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Delling, U., Raymond, M., Schurr, E. (1998). "Identification of Saccharomyces cerevisiae genes conferring resistance to quinoline ring-containing antimalarial drugs." Antimicrob Agents Chemother 42:1034-1041.9593122
  • Tomitori, H., Kashiwagi, K., Asakawa, T., Kakinuma, Y., Michael, A. J., Igarashi, K. (2001). "Multiple polyamine transport systems on the vacuolar membrane in yeast." Biochem J 353:681-688.11171066
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Albertsen, M., Bellahn, I., Kramer, R., Waffenschmidt, S. (2003). "Localization and function of the yeast multidrug transporter Tpo1p." J Biol Chem 278:12820-12825.12562762
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Aranda, A., del Olmo, M. L. (2004). "Exposure of Saccharomyces cerevisiae to acetaldehyde induces sulfur amino acid metabolism and polyamine transporter genes, which depend on Met4p and Haa1p transcription factors, respectively." Appl Environ Microbiol 70:1913-1922.15066780
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956