You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameType 2A phosphatase activator TIP41
Synonyms
  • PP2A phosphatase activator TIP41
  • TAP42-interacting protein 1
Gene NameTIP41
Enzyme ClassNot Available
Biological Properties
General Functionsignal transduction
Specific FunctionInvolved in negative regulation of the TOR signaling pathway in response to type of available nitrogen source. Indirectly activates the PP2A phosphatase SIT4 via interaction with its suppressor TAP42. This interaction is enhanced under nitrogen limitation conditions. Also has a role in regulation of NPR1 in response to nitrogen limitation.
Cellular LocationNot Available
SMPDB Pathways
TOR signalling pathway: Rapamycin based repressionPW002514 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
nucleus
cytoplasm
negative regulation of signal transduction
signal transduction
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1071 bp ATGTCCAAAAGAAACACTCCACCGCTCAGATCATCAGGGATAAACACTATTCAAATAAAT GCTGCTAGAGAAATGCACGCTCAAACGGTGCGCGCTCGAAGAATGCCCATGCCAACTAGC GGCATCACTACACCCTCTGTGCAACCAACTGCAGCCCCAGCAACACCACCTCGACATATT TGCAATAACCCAAACAATCCGCAGTGTCTCCACTGTGGGTCTGTTATCATTCCATCTCCA AGGGCCACGTTACCCTTGGAGGACAACCCCTCCATCTCCATCAACGACTGGACCATCTCC TCCAGAAAGAAGCCCATTTTGAACTCGCAGGAATTAGACATCTGGGAAAACGAAAAACTC AAAGGTTTGACTTTGCCAGAGATGATTTTTGGTAACAACTACATCAGGATCGAAAATTCA AAACAGCATTGGTCCATAGAGTTCAATGCCCTGGATGCTTTAAAGGAGGTTCAACTCCAG GATTCAGGTATTCGTGTTGCGTACTCAAACGACTGGATAAATTCTAAAAAAAGACAAAAT TCAACTAATGGTGCGCAACGGTTCACTAACGATGTGAACGACGATTCCTTAAATATCATA CACAAGTACGACTGGACCTACACTACGCGGTATAAGGGCACAGAGAGCTCACCTGAGTCG AAATTCCGACTGGATAACGATCAAAAGCTGCCCCTTGACAAACTGGCCGTACACGATAAA ATCCTATTCTATGACGACATGATTCTTTTCGAAGACGAATTGGCAGACAATGGCATATCA ATCCTTAACGTCAAAATAAGAGTTATGAACGAAAGGTTACTGCTGCTGAGCCGGTTCTTT TTAAGGGTGGACGATGTTCTGGTGAGGGTCTACGACACCAGGATTTACGTGGAGTTTGAC GAAAACGTAGTGATCAGAGAATCCAAGGAATTTGAAGGTAAATATCAGGATGTACTTGCT AAGCACCGGCTATCCCAATCTCACGACCCAAAAGCTGCCTTGAGAGATAGTAATTGGGTA GCACAGAACACGCCGATGATCAAAAGACAATGTGAAATAATTCAGTTCTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues356
Protein Molecular Weight41019.135
Protein Theoretical pINot Available
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Type 2A phosphatase activator TIP41 MSKRNTPPLRSSGINTIQINAAREMHAQTVRARRMPMPTSGITTPSVQPTAAPATPPRHI CNNPNNPQCLHCGSVIIPSPRATLPLEDNPSISINDWTISSRKKPILNSQELDIWENEKL KGLTLPEMIFGNNYIRIENSKQHWSIEFNALDALKEVQLQDSGIRVAYSNDWINSKKRQN STNGAQRFTNDVNDDSLNIIHKYDWTYTTRYKGTESSPESKFRLDNDQKLPLDKLAVHDK ILFYDDMILFEDELADNGISILNVKIRVMNERLLLLSRFFLRVDDVLVRVYDTRIYVEFD ENVVIRESKEFEGKYQDVLAKHRLSQSHDPKAALRDSNWVAQNTPMIKRQCEIIQF
References
External Links
ResourceLink
Saccharomyces Genome Database TIP41
Uniprot IDQ12199
Uniprot NameTIP41
General ReferenceNot Available