You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRibose-5-phosphate isomerase
Synonyms
  • D-ribose-5-phosphate ketol-isomerase
  • Phosphoriboisomerase
Gene NameRKI1
Enzyme Class
Biological Properties
General FunctionInvolved in ribose-5-phosphate isomerase activity
Specific FunctionD-ribose 5-phosphate = D-ribulose 5-phosphate
Cellular LocationNot Available
SMPDB Pathways
RiboneogenesisPW002511 ThumbThumb?image type=greyscaleThumb?image type=simple
xylitol degradationPW002433 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose phosphate pathwayec00030 Map00030
SMPDB Reactions
D-ribulose 5-phosphateD-Ribose 5-phosphate
D-Ribose 5-phosphateD-ribulose 5-phosphate
KEGG Reactions
alpha-D-ribose 5-phosphateD-ribulose 5-phosphate
Metabolites
YMDB IDNameView
YMDB00119D-Ribose 5-phosphateShow
YMDB00650alpha-D-ribose 5-phosphateShow
YMDB00948D-ribulose 5-phosphateShow
GO Classification
Component
Not Available
Function
ribose-5-phosphate isomerase activity
catalytic activity
isomerase activity
intramolecular oxidoreductase activity
intramolecular oxidoreductase activity, interconverting aldoses and ketoses
Process
pentose-phosphate shunt, non-oxidative branch
metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
pentose metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR095C
Gene Sequence>777 bp ATGGCTGCCGGTGTCCCAAAAATTGATGCGTTAGAATCTTTGGGCAATCCTTTGGAGGAT GCCAAGAGAGCTGCAGCATACAGAGCAGTTGATGAAAATTTAAAATTTGATGATCACAAA ATTATTGGAATTGGTAGTGGTAGCACAGTGGTTTATGTTGCCGAAAGAATTGGACAATAT TTGCATGACCCTAAATTTTATGAAGTAGCGTCTAAATTCATTTGCATTCCAACAGGATTC CAATCAAGAAACTTGATTTTGGATAACAAGTTGCAATTAGGCTCCATTGAACAGTATCCT CGCATTGATATAGCGTTTGACGGTGCTGATGAAGTGGATGAGAATTTACAATTAATTAAA GGTGGTGGTGCTTGTCTATTTCAAGAAAAATTGGTTAGTACTAGTGCTAAAACCTTCATT GTCGTTGCTGATTCAAGAAAAAAGTCACCAAAACATTTAGGTAAGAACTGGAGGCAAGGT GTTCCCATTGAAATTGTACCTTCCTCATACGTGAGGGTCAAGAATGATCTATTAGAACAA TTGCATGCTGAAAAAGTTGACATCAGACAAGGAGGTTCTGCTAAAGCAGGTCCTGTTGTA ACTGACAATAATAACTTCATTATCGATGCGGATTTCGGTGAAATTTCCGATCCAAGAAAA TTGCATAGAGAAATCAAACTGTTAGTGGGCGTGGTGGAAACAGGTTTATTCATCGACAAC GCTTCAAAAGCCTACTTCGGTAATTCTGACGGTAGTGTTGAAGTTACCGAAAAGTGA
Protein Properties
Pfam Domain Function
Protein Residues258
Protein Molecular Weight28257.80078
Protein Theoretical pI5.72
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ribose-5-phosphate isomerase MAAGVPKIDALESLGNPLEDAKRAAAYRAVDENLKFDDHKIIGIGSGSTVVYVAERIGQY LHDPKFYEVASKFICIPTGFQSRNLILDNKLQLGSIEQYPRIDIAFDGADEVDENLQLIK GGGACLFQEKLVSTSAKTFIVVADSRKKSPKHLGKNWRQGVPIEIVPSSYVRVKNDLLEQ LHAEKVDIRQGGSAKAGPVVTDNNNFIIDADFGEISDPRKLHREIKLLVGVVETGLFIDN ASKAYFGNSDGSVEVTEK
References
External Links
ResourceLink
Saccharomyces Genome Database RKI1
Uniprot IDQ12189
Uniprot NameRPIA_YEAST
GenBank Gene IDX94335
Genebank Protein ID1164942
General Reference
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Miosga, T., Zimmermann, F. K. (1996). "Cloning and characterization of the first two genes of the non-oxidative part of the Saccharomyces cerevisiae pentose-phosphate pathway." Curr Genet 30:404-409.8929392
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106