Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytosine deaminase
Synonyms
  • Cytosine aminohydrolase
Gene NameFCY1
Enzyme Class
Biological Properties
General FunctionInvolved in zinc ion binding
Specific FunctionConverts cytosine to uracil or 5-methylcytosine to thymine by deaminating carbon number 4
Cellular LocationCytoplasmic
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
Cytosine + water + hydronUracil + Ammonium
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00098UracilShow
YMDB00423AmmoniumShow
YMDB00651CytosineShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
zinc ion binding
hydrolase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 16
LocusYPR062W
Gene Sequence>477 bp ATGGTGACAGGGGGAATGGCAAGCAAGTGGGATCAGAAGGGTATGGACATTGCCTATGAG GAGGCGGCCTTAGGTTACAAAGAGGGTGGTGTTCCTATTGGCGGATGTCTTATCAATAAC AAAGACGGAAGTGTTCTCGGTCGTGGTCACAACATGAGATTTCAAAAGGGTTCCGCCACA CTACATGGTGAGATCTCCACTTTGGAAAACTGTGGGAGATTAGAGGGCAAAGTGTACAAA GATACCACTTTGTATACGACGCTGTCTCCATGCGACATGTGTACAGGTGCCATCATCATG TATGGTATTCCACGCTGTGTTGTCGGTGAGAACGTTAATTTCAAAAGTAAGGGCGAGAAA TATTTACAAACTAGAGGTCACGAGGTTGTTGTTGTTGACGATGAGAGGTGTAAAAAGATC ATGAAACAATTTATCGATGAAAGACCTCAGGATTGGTTTGAAGATATTGGTGAGTAG
Protein Properties
Pfam Domain Function
Protein Residues158
Protein Molecular Weight17506.90039
Protein Theoretical pI5.73
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytosine deaminase MVTGGMASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSAT LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEK YLQTRGHEVVVVDDERCKKIMKQFIDERPQDWFEDIGE
References
External Links
ResourceLink
Saccharomyces Genome Database FCY1
Uniprot IDQ12178
Uniprot NameFCY1_YEAST
GenBank Gene IDAF005261
Genebank Protein ID2343114
PDB ID
1UAQ
General Reference
  • Erbs, P., Exinger, F., Jund, R. (1997). "Characterization of the Saccharomyces cerevisiae FCY1 gene encoding cytosine deaminase and its homologue FCA1 of Candida albicans." Curr Genet 31:1-6.9000374
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Ko, T. P., Lin, J. J., Hu, C. Y., Hsu, Y. H., Wang, A. H., Liaw, S. H. (2003). "Crystal structure of yeast cytosine deaminase. Insights into enzyme mechanism and evolution." J Biol Chem 278:19111-19117.12637534
  • Ireton, G. C., Black, M. E., Stoddard, B. L. (2003). "The 1.14 A crystal structure of yeast cytosine deaminase: evolution of nucleotide salvage enzymes and implications for genetic chemotherapy." Structure 11:961-972.12906827