You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameEndo-1,3(4)-beta-glucanase 2
Synonyms
  • Endo-1,3-beta-glucanase 2
  • Endo-1,4-beta-glucanase 2
  • Laminarinase-2
Gene NameACF2
Enzyme Class
Biological Properties
General FunctionInvolved in endo-1,3(4)-beta-glucanase activity
Specific FunctionEndohydrolysis of (1->3)- or (1->4)-linkages in beta-D-glucans when the glucose residue whose reducing group is involved in the linkage to be hydrolyzed is itself substituted at C-3
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
endo-1,3(4)-beta-glucanase activity
Process
metabolic process
catabolic process
cell wall macromolecule catabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR144C
Gene Sequence>2340 bp ATGTGTTACAGTAGGCAAGCCATTCCTCCACCTGTTCCTAATAGACCTGGCGGTACTACC AATAGAGGACCTCCTCCCTTACCACCTCGCGCAAATGTTCAGCCACCAGTTTGTTCTTCT GAGAACTCCAGTAAACCTCGAGAAAATAGGGTGGCAGGTGAATCACTGCGCACACCAAGC AGTTCTAACCCTTTAGCTGACAGCCAGGTGAATAGTGACAATATTTTTCAATCACCTGTC CTTTCTAACTTAAAAGCTCCTCCTTCCGTCTTCAACAAAGTTCAACACCCGGTACCAAAG CCGAATATTGATGATCAATCTGTTGATCCATTGGAGACAAACAAGTTCTACACAAACATG TTATTAGACGATAATACACAACCTATATGGACACATCCTTATTCAATTTGGTTTTCTCGT GATCCAGAATTGTTTGGTTTGGCCGCCAATCATACTTTAGCGTCTCAAAGGGTTTTTGAT ACAACTACAAATCCTCCCAGATTCTACTTCAATCCCACAAATATAAAATCATTTGTATTC AAGGCCAGGGAATTTGTCTCTTCAAATGATATCAAGCTTGAATTCCGGGATATGAAACAT ATGTCCATGTGCTTACTAATGTCTTTGAGTAGTTCCCAGTTTATAGAATTCCCGCTGGTT CAGGGGATGGGCTTTGTCACGGCTATTTACCACGATTTGGGTTTTGAATTAAGAAGCGCC GTTGGTTTCAGGAGCTTAGAGCGCATAAGCGTGAATGAAAGATATGGTAAATATAATATA CAACTTGAGAATAATAGGAATTGGATACTTTATTTGACCTCACCTGATTACTCTTTTCCA CAAGATTTTCAAATTTCATTACTCGACAGCAATACAATAATATCATCTCATAAAATCAAT GGTCTTATCTGTCAATTATCTGCAGACTCCGTCCCCAGTATTGACATGGCAGCGGGCTGT TATCCAGTATACTGTGACCTATCAGGGCAAACTGTTGATGAACATTTCACAAATTACAGA TTTAACTATACGGTTGCAGGCTACTCGCAGTCTGGAACTACTCTAATGTATGCTTTACCA CATCATAAAGCGGCATTCACACCAGAAATGCAGGAACGTGAAATTGCCTCAAGCCTGGAT TCCACAGTTAAAGGCTTAATGACTGGTTATCTCACAAACAGTTTTGATATGCAGGTTCAA GTACCTCAAGAATTGGGCTTTGAACCTGTCGCGTTATCTTTGAATAAGAAGGCAGATTAC AGTCAAGAAAAGCTATCTAAAATTCGGGAAGCTGCTGTTCAAGAAGTTCAATTGAGTGAC CCTCAACAAGAATCAAACATAGATTCTATGTATTTCTCTGGTAAGATACTTGCAAAGTAT GCGTGGATTCTTTATGTGACACATTACATCCTTCATGATGAAAATTTAACAAAAGAATTA TTATCTAAACTGACTATTGCAATGGAGAGATTCATCAGCAATCAGCAAGTCTTACCTTTA AATTACGACGTTAGTTGGAAAGGCATAATTTCATCAGGCTCTTCTAGCCAAGACTTTGGT AACTCTTATTATAATGATCATCATTTTCATTACTCTTATCATGTCATAACGGCTGCCATT ATCTCTTTAGTCGATTCTGATTTAAGTGGAGTTACTAACAACTCCTGGTTAGAAAATAAT AGAGATTGGGTTGAGTGCTTAATTAGAGATTACTCTGGTGTTGACAACGATGATCCGTAC TTCCCTCAATTTAGGTCATTTGATTGGTTTAATGGCCATTCATGGGCCAAAGGACTATTT CCAAGTGGTGACGGTAAAGATGAAGAATCTACTTCAGAAGATGTCAATTCTTGCTATGCG ATAAAATTGTGGGGGTTGGTAACTGGAAATTCTAAGTTAACTGACATAGCGAACTTACAA CTCGGCATCATGAGAAATGTTTTCCAGAGCTACTTCCTATACGAAAGCAATAATACTGTC CAACCGAAAGAATTTATTGGTAATAAAGTTAGTGGTATTTTATTCGAAAATAAAATTGAT CACGCCACGTATTTTGGCATGGAGCCTCAATACATTCATATGATTCACGCCATTCCTATA ACATCAGCATCTTCATGGGTCAGAACACCAAATTTTGTCAAAGAGGAGTGGGAAGAAAAA ATGCAGCCGATAATTGATCAAGTGAATGACGGTTGGAAAGGAATAATCATGTTAAATATG GCTCTGCTTGATCCAAAATTTTCGTACGACTTTTTCAGCCAACCTGATTTCAACAGAAAT TTCCTAGACAATGGGCAAAGCTTAACTTGGTCTTTAGCTTATTCAGGTGCTTTTTCTTAG
Protein Properties
Pfam Domain Function
Protein Residues779
Protein Molecular Weight88402.5
Protein Theoretical pI5.07
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Endo-1,3(4)-beta-glucanase 2 MCYSRQAIPPPVPNRPGGTTNRGPPPLPPRANVQPPVCSSENSSKPRENRVAGESLRTPS SSNPLADSQVNSDNIFQSPVLSNLKAPPSVFNKVQHPVPKPNIDDQSVDPLETNKFYTNM LLDDNTQPIWTHPYSIWFSRDPELFGLAANHTLASQRVFDTTTNPPRFYFNPTNIKSFVF KAREFVSSNDIKLEFRDMKHMSMCLLMSLSSSQFIEFPLVQGMGFVTAIYHDLGFELRSA VGFRSLERISVNERYGKYNIQLENNRNWILYLTSPDYSFPQDFQISLLDSNTIISSHKIN GLICQLSADSVPSIDMAAGCYPVYCDLSGQTVDEHFTNYRFNYTVAGYSQSGTTLMYALP HHKAAFTPEMQEREIASSLDSTVKGLMTGYLTNSFDMQVQVPQELGFEPVALSLNKKADY SQEKLSKIREAAVQEVQLSDPQQESNIDSMYFSGKILAKYAWILYVTHYILHDENLTKEL LSKLTIAMERFISNQQVLPLNYDVSWKGIISSGSSSQDFGNSYYNDHHFHYSYHVITAAI ISLVDSDLSGVTNNSWLENNRDWVECLIRDYSGVDNDDPYFPQFRSFDWFNGHSWAKGLF PSGDGKDEESTSEDVNSCYAIKLWGLVTGNSKLTDIANLQLGIMRNVFQSYFLYESNNTV QPKEFIGNKVSGILFENKIDHATYFGMEPQYIHMIHAIPITSASSWVRTPNFVKEEWEEK MQPIIDQVNDGWKGIIMLNMALLDPKFSYDFFSQPDFNRNFLDNGQSLTWSLAYSGAFS
References
External Links
ResourceLink
Saccharomyces Genome Database ACF2
Uniprot IDQ12168
Uniprot NameENG2_YEAST
GenBank Gene IDU53879
Genebank Protein ID1262304
General Reference
  • Baladron, V., Ufano, S., Duenas, E., Martin-Cuadrado, A. B., del Rey, F., Vazquez de Aldana, C. R. (2002). "Eng1p, an endo-1,3-beta-glucanase localized at the daughter side of the septum, is involved in cell separation in Saccharomyces cerevisiae." Eukaryot Cell 1:774-786.12455695
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Mrsa, V., Klebl, F., Tanner, W. (1993). "Purification and characterization of the Saccharomyces cerevisiae BGL2 gene product, a cell wall endo-beta-1,3-glucanase." J Bacteriol 175:2102-2106.8458852
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Martin-Cuadrado, A. B., Fontaine, T., Esteban, P. F., del Dedo, J. E., de Medina-Redondo, M., del Rey, F., Latge, J. P., de Aldana, C. R. (2008). "Characterization of the endo-beta-1,3-glucanase activity of S. cerevisiae Eng2 and other members of the GH81 family." Fungal Genet Biol 45:542-553.17933563
  • Cappellaro, C., Mrsa, V., Tanner, W. (1998). "New potential cell wall glucanases of Saccharomyces cerevisiae and their involvement in mating." J Bacteriol 180:5030-5037.9748433