You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name2-isopropylmalate synthase 2, mitochondrial
Synonyms
  • Alpha-IPM synthase 2
  • Alpha-isopropylmalate synthase 2
  • Alpha-isopropylmalate synthase II
Gene NameLEU9
Enzyme Class
Biological Properties
General FunctionInvolved in 2-isopropylmalate synthase activity
Specific FunctionCatalyzes the condensation of the acetyl group of acetyl-CoA with 3-methyl-2-oxobutanoate (2-oxoisovalerate) to form 3-carboxy-3-hydroxy-4-methylpentanoate (2-isopropylmalate). Redundant to LEU4, responsible of about 20% of alpha-IPMS activity. Involved in leucine synthesis
Cellular LocationMitochondrion
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyruvate metabolismec00620 Map00620
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB Reactions
2-Isopropylmalic acid + Coenzyme AAcetyl-CoA + water + Alpha-Ketoisovaleric acid
KEGG Reactions
Acetyl-CoA + Alpha-Ketoisovaleric acid + water2-Isopropylmalic acid + hydron + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB001062-Isopropylmalic acidShow
YMDB00312Acetyl-CoAShow
YMDB00365Alpha-Ketoisovaleric acidShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
transferase activity
2-isopropylmalate synthase activity
transferase activity, transferring acyl groups
Process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
branched chain family amino acid metabolic process
metabolic process
leucine metabolic process
cellular metabolic process
leucine biosynthetic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR108W
Gene Sequence>1815 bp ATGGTAAAACATTCGTTCATAGCGCTAGCTGAGCATGCTAGTAAACTAAGAAGGTCTATC CCACCCGTCAAACTGACTTATAAAAATATGCTACGGGACCCATCGGTAAAATATAGGGCG TTTGCTCCACCAAAAATGGTCAAGAGGATTTGGCCTGACAAAACTATTCAAAAGGCTCCA CGTTGGCTGTCTACTGACTTGAGGGACGGTAATCAATCTTTACCGGACCCAATGTCTGTG GCTCAAAAGAAAGAATATTTCCACAAGTTGATCAACATCGGTTTCAAAGAAATCGAAGTG TCTTTCCCCTCTGCATCTCAAACAGATTTCGACTTCACCAGGTATGCTGTAGAAAACGCT CCAGATGATGTTGGTATTCAATGTCTTGTCCAATCTAGAGAACACTTGATTAAAAGAACC GTGGAAGCATTGACTGGTGCTAAAAGGGCTACCATACATACTTACTTGGCCACAAGTGAC ATGTTCCGAGAAATTGTCTTCAATATGTCTAGAGAGGAAGCTATTTCTAAAGCTGTAGAA GCCACCAAACTGGTTAGGAAACTAACCAAGGATGACCCTTCCCAGCAAGCTACTCGTTGG TCCTATGAGTTTTCTCCCGAATGTTTCAGTGATACGCCAGGTGAATTTGCTGTAGAAATT TGTGAAGCTGTTAAAAAGGCTTGGGAACCTACCGAGGAAAATCCGATCATTTTCAACTTA CCAGCTACTGTAGAAGTTGCCTCTCCAAATGTTTACGCTGATCAAATTGAGTACTTCTCT ACCCACATTACTGAGCGTGAGAAGGTCTGTATTTCTACGCATTGTCACAATGACCGTGGT TGCGGTGTCGCCGCCACAGAATTAGGTATGCTTGCAGGCGCTGATCGTGTAGAAGGTTGT CTATTTGGTAATGGTGAACGTACAGGTAATGTTGATTTGGTTACAGTTGCCATGAATATG TATACCCAAGGTGTTTCTCCTAATTTAGATTTCTCAGATTTAACTTCAATTTCTGAAATT GTCCATCGCTGTAACAAGATTCCAATTCCCCCAAGAGCCCCATATGGCGGTGAATTGGTT GTTTCTGCCTTTTCTGGTTCTCATCAGGATGCAATTAAGAAGGGATTTGCAATCCAAAAC AAGAAACAGGCTCAAGGAGAAACTCGGTGGAGAATTCCATACTTACCATTGGATCCAAAG GATATTGGACGTGATTACGAAGCCGTCATCAGAGTCAACTCTCAATCCGGTAAGGGTGGT GCTGCTTGGGTTATTATGAGATCTCTAGGATTAGATGTACCAAGACCAATGCAAGTTGAT TTCTCCAATACTCTACAGAAAAATGCAGATGCCTTAGGAAGAGAGTTAAAATCCGAAGAG ATTACAAAATTGTTCAAAGAAACTTACAACTACAACAACAATGAACATATATACGTCACC TTGTTGAATTACGAAGTTAAGAAATTGAACCCAGAGCGTAGAGCTTTAGTGGGCCAGGTA GAAATCAACGATAAGGTTGTCAACATCGAAGGCTACGGAAATGGTCCTATCTCTTCTTTG GTGGATGCGCTATCCAATTTACTGAATGTTAAGTTGAGCGTTCAAAACTACTCTGAACAT TCCTTGGGTTCTGGTTCTGCAACCCAAGCGGCATCTTTCATAAATCTTTCCTACATAAAG GACATCAATAATCATGCTACTAGTAATATGTGGGGTGTTGGTGTCTCCGAAGACACTGGG GATGCATCTATTAAGGCGGTATTTGCTACTGTCAATAATATTATTCATTCCGGGGATGTT CTACTGGCAGAGTAA
Protein Properties
Pfam Domain Function
Protein Residues604
Protein Molecular Weight67199.60156
Protein Theoretical pI6.75
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>2-isopropylmalate synthase 2, mitochondrial MVKHSFIALAEHASKLRRSIPPVKLTYKNMLRDPSVKYRAFAPPKMVKRIWPDKTIQKAP RWLSTDLRDGNQSLPDPMSVAQKKEYFHKLINIGFKEIEVSFPSASQTDFDFTRYAVENA PDDVGIQCLVQSREHLIKRTVEALTGAKRATIHTYLATSDMFREIVFNMSREEAISKAVE ATKLVRKLTKDDPSQQATRWSYEFSPECFSDTPGEFAVEICEAVKKAWEPTEENPIIFNL PATVEVASPNVYADQIEYFSTHITEREKVCISTHCHNDRGCGVAATELGMLAGADRVEGC LFGNGERTGNVDLVTVAMNMYTQGVSPNLDFSDLTSISEIVHRCNKIPIPPRAPYGGELV VSAFSGSHQDAIKKGFAIQNKKQAQGETRWRIPYLPLDPKDIGRDYEAVIRVNSQSGKGG AAWVIMRSLGLDVPRPMQVDFSNTLQKNADALGRELKSEEITKLFKETYNYNNNEHIYVT LLNYEVKKLNPERRALVGQVEINDKVVNIEGYGNGPISSLVDALSNLLNVKLSVQNYSEH SLGSGSATQAASFINLSYIKDINNHATSNMWGVGVSEDTGDASIKAVFATVNNIIHSGDV LLAE
References
External Links
ResourceLink
Saccharomyces Genome Database LEU9
Uniprot IDQ12166
Uniprot NameLEU9_YEAST
GenBank Gene IDX94335
Genebank Protein ID1262141
General Reference
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Casalone, E., Barberio, C., Cavalieri, D., Polsinelli, M. (2000). "Identification by functional analysis of the gene encoding alpha-isopropylmalate synthase II (LEU9) in Saccharomyces cerevisiae." Yeast 16:539-545.10790691
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106