You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTryptophanyl-tRNA synthetase, cytoplasmic
Synonyms
  • Tryptophan--tRNA ligase
  • TrpRS
Gene NameWRS1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-tryptophan + tRNA(Trp) = AMP + diphosphate + L-tryptophyl-tRNA(Trp)
Cellular LocationCytoplasm
SMPDB Pathways
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Tryptophan metabolismec00380 Map00380
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + tRNA(Trp) + L-TryptophanAdenosine monophosphate + Pyrophosphate + Trp-tRNA(Trp)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00126L-TryptophanShow
YMDB00219PyrophosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ligase activity, forming carbon-oxygen bonds
ligase activity
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
tryptophan-tRNA ligase activity
binding
nucleotide binding
nucleoside binding
purine nucleoside binding
catalytic activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
Process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
biosynthetic process
tryptophanyl-tRNA aminoacylation
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA aminoacylation
metabolic process
tRNA aminoacylation for protein translation
macromolecule metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOL097C
Gene Sequence>1299 bp ATGAGCAACGACGAAACTGTAGAGAAAGTCACCCAACAAGTGTCGGAACTAAAAAGCACA GATGTTAAAGAGCAAGTAGTTACACCTTGGGATGTGGAAGGTGGGGTTGATGAACAAGGT AGAGCCCAAAATATTGATTACGACAAATTGATCAAACAATTCGGTACTAAGCCGGTCAAC GAAGAAACCCTGAAGAGATTCAAGCAAGTGACGGGTCGTGAACCACATCATTTTTTGCGT AAGGGATTGTTTTTCAGTGAGCGTGACTTCACTAAAATATTAGACCTTTACGAACAAGGC AAACCATTTTTCCTATACACTGGTAGAGGTCCTTCGAGCGATTCTATGCACTTGGGTCAT ATGATCCCTTTTGTCTTCACCAAATGGTTACAGGAAGTGTTTGACGTACCATTAGTCATA GAGTTGACAGATGACGAAAAATTTTTATTCAAACACAAGTTGACCATCAATGACGTTAAG AATTTTGCCCGTGAAAATGCCAAGGATATCATTGCTGTTGGCTTTGATCCAAAGAACACC TTTATCTTTTCTGATTTGCAATACATGGGTGGTGCATTTTACGAAACTGTAGTAAGAGTT TCCAGACAAATTACAGGATCCACTGCAAAGGCTGTTTTCGGGTTTAATGACTCCGACTGT ATTGGTAAGTTCCATTTTGCCTCCATTCAAATTGCTACCGCATTCCCAAGCTCATTTCCT AATGTGTTAGGCTTGCCTGATAAGACACCATGTTTGATTCCATGTGCAATTGACCAAGAT CCATATTTCAGAGTTTGTAGGGATGTCGCGGATAAATTGAAGTACTCCAAACCTGCTTTG CTTCATTCCAGATTCTTTCCAGCTTTGCAAGGTTCCACGACCAAAATGTCAGCCTCTGAT GATACCACTGCCATTTTCATGACCGATACACCAAAGCAAATTCAAAAGAAAATTAACAAG TACGCATTCAGCGGTGGTCAAGTGTCCGCCGACCTACATAGAGAATTAGGTGGTAATCCC GATGTCGATGTTGCATACCAATACTTGTCATTTTTCAAGGATGACGATGTTTTCTTGAAG GAATGCTATGACAAATATAAGTCCGGTGAATTACTATCAGGTGAAATGAAGAAACTGTGT ATCGAGACTCTGCAAGAATTCGTTAAGGCGTTCCAGGAACGCAGAGCTCAGGTGGACGAA GAGACCTTGGACAAATTCATGGTCCCACATAAGTTGGTTTGGGGCGAAAAGGAAAGACTT GTCGCACCTAAGCCAAAAACTAAGCAAGAAAAGAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues432
Protein Molecular Weight49350.0
Protein Theoretical pI6.79
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Tryptophanyl-tRNA synthetase, cytoplasmic MSNDETVEKVTQQVSELKSTDVKEQVVTPWDVEGGVDEQGRAQNIDYDKLIKQFGTKPVN EETLKRFKQVTGREPHHFLRKGLFFSERDFTKILDLYEQGKPFFLYTGRGPSSDSMHLGH MIPFVFTKWLQEVFDVPLVIELTDDEKFLFKHKLTINDVKNFARENAKDIIAVGFDPKNT FIFSDLQYMGGAFYETVVRVSRQITGSTAKAVFGFNDSDCIGKFHFASIQIATAFPSSFP NVLGLPDKTPCLIPCAIDQDPYFRVCRDVADKLKYSKPALLHSRFFPALQGSTTKMSASD DTTAIFMTDTPKQIQKKINKYAFSGGQVSADLHRELGGNPDVDVAYQYLSFFKDDDVFLK ECYDKYKSGELLSGEMKKLCIETLQEFVKAFQERRAQVDEETLDKFMVPHKLVWGEKERL VAPKPKTKQEKK
References
External Links
ResourceLink
Saccharomyces Genome Database WRS1
Uniprot IDQ12109
Uniprot NameSYWC_YEAST
GenBank Gene IDZ48149
Genebank Protein ID663256
General Reference
  • Vandenbol, M., Durand, P., Portetelle, D., Hilger, F. (1995). "Sequence analysis of a 44 kb DNA fragment of yeast chromosome XV including the Tyl-H3 retrotransposon, the suf1(+) frameshift suppressor gene for tRNA-Gly, the yeast transfer RNA-Thr-1a and a delta element." Yeast 11:1069-1075.7502582
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • John, T. R., Ghosh, M., Johnson, J. D. (1997). "Identification and expression of the Saccharomyces cerevisiae cytoplasmic tryptophanyl-tRNA synthetase gene." Yeast 13:37-41.9046085
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956