You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative uridine kinase YDR020C
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionATP + uridine = ADP + UMP
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00049Uridine 5'-monophosphateShow
YMDB00051CytidineShow
YMDB00109Adenosine triphosphateShow
YMDB00127UridineShow
YMDB00406Cytidine monophosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
kinase activity
phosphotransferase activity, alcohol group as acceptor
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYDR020C
Gene Sequence>699 bp ATGGACAGAAAAGCTGTCGAAGAAAAAAGAATTGTTATTTCTATCGGTGGAGGGCATGCT ACTGGTGTTGGAGCAATTGCACTGGATTTACAAAATACTTTCAAAAGCCTATATAACTCT ATCAATATAAGGGTAATAAACCTAGATAATATGATAGAAGGGAACATCAAGAGCTACAAT AATAACGACTATGATTTTGATAATATCCTTAATTTGGTATATGAAAAGCACGCTGTAACT TCTCAAAATGACATGATTCAACATGATTACGAGGACCCGATAGATTTGATAATAGTATGT GGCTGTTATGCGCTATACGATAAACGCATCAACGAAATATCTCAATTAAAGGTATTCTTG GATAGTGATGCAGATAAAAGATTAATTAGTCTAATCAAGAAGAAGAACGTAGGGAGCAAT GAACAACTAGCCCAGTTGATCACTGAGTATATGGACCATCTGCGCCCGGAGATGCAACAA TATATAGAGCCCACTAGAACTTTTGCAGATTTGATCATTCCTTCTACAAATGAAAATCTA GGGCGCGCAGTCCTCGTGGACGGTATAGTTAAAGCAATCGAAGATACCAAAAGCCAAATA GAAGGCAACAATACGAACAACAAAATACGCCCACGTTTATGGGATTTCGAAGCTGAAACA ATGGACTTGGAGAAAGATAGATATTACGATCTGTCATGA
Protein Properties
Pfam Domain Function
Protein Residues232
Protein Molecular Weight26594.80078
Protein Theoretical pI4.57
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative uridine kinase YDR020C MDRKAVEEKRIVISIGGGHATGVGAIALDLQNTFKSLYNSINIRVINLDNMIEGNIKSYN NNDYDFDNILNLVYEKHAVTSQNDMIQHDYEDPIDLIIVCGCYALYDKRINEISQLKVFL DSDADKRLISLIKKKNVGSNEQLAQLITEYMDHLRPEMQQYIEPTRTFADLIIPSTNENL GRAVLVDGIVKAIEDTKSQIEGNNTNNKIRPRLWDFEAETMDLEKDRYYDLS
References
External Links
ResourceLink
Saccharomyces Genome Database YDR020C
Uniprot IDQ12084
Uniprot NameYD020_YEAST
GenBank Gene IDAY558571
Genebank Protein ID45271032
General Reference
  • Eide, L. G., Sander, C., Prydz, H. (1996). "Sequencing and analysis of a 35.4 kb region on the right [corrected] arm of chromosome IV from Saccharomyces cerevisiae reveal 23 open reading frames." Yeast 12:1085-1090.8896275
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106