Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative adenylate kinase FAP7
Synonyms
  • ATP-AMP transphosphorylase FAP7
  • POS9-activating factor 7
Gene NameFAP7
Enzyme Class
Biological Properties
General FunctionNucleotide transport and metabolism
Specific FunctionRequired for the activation of POS9 and for stabilizing its interaction with the transcriptosome in response to oxidative stress. Required for 20S rRNA processing at site D
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00914ADPShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDL166C
Gene Sequence>594 bp ATGGAAGCAAGACGGTATGGACCGAATATCATTGTTACAGGAACACCAGGATGTGGCAAG TCGTCTACGTGTGAGTTTTTAAAAAATAAACTGAAGGATTACAAATACTATAACATTTCG GATTTCGCCAAAGATAACGACTGTTTCGAAGGATATGATGAGGGCCGTAAATCGCACATT GTCGATGAAGACAAACTGCTGGACATGCTAGAGCCTCTTTTGAGACAGGGAAATAGTATT GTCGATTGGCATGTCAATGATGTGTTCCCAGAGAGGCTGATTGACTTGGTGGTGGTGTTG AGATGCGATAACTCTAACTTGTATTCAAGATTGCATGCAAGAGGCTATCATGACTCTAAG ATCGAGGAAAACCTCGATGCCGAGATTATGGGTGTCGTCAAACAGGATGCCGTGGAATCA TACGAACCGCACATTGTGGTAGAGCTACAAAGCGATACGAAAGAAGATATGGTATCTAAC GTATCCCGTATTGTTGCTTGGGAAAAGATGTGGTTAGAACAACATCCAGATGGAGTCACA AATGAATATCAAGGGCCTCGTAGCGATGACGAAGACGATGAAGACAGTGAGTAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues197
Protein Molecular Weight22723.0
Protein Theoretical pI4.27
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative adenylate kinase FAP7 MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT NEYQGPRSDDEDDEDSE
References
External Links
ResourceLink
Saccharomyces Genome Database FAP7
Uniprot IDQ12055
Uniprot NameKAD6_YEAST
GenBank Gene IDZ67750
Genebank Protein ID1061273
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Juhnke, H., Charizanis, C., Latifi, F., Krems, B., Entian, K. D. (2000). "The essential protein fap7 is involved in the oxidative stress response of Saccharomyces cerevisiae." Mol Microbiol 35:936-948.10692169
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Peng, W. T., Robinson, M. D., Mnaimneh, S., Krogan, N. J., Cagney, G., Morris, Q., Davierwala, A. P., Grigull, J., Yang, X., Zhang, W., Mitsakakis, N., Ryan, O. W., Datta, N., Jojic, V., Pal, C., Canadien, V., Richards, D., Beattie, B., Wu, L. F., Altschuler, S. J., Roweis, S., Frey, B. J., Emili, A., Greenblatt, J. F., Hughes, T. R. (2003). "A panoramic view of yeast noncoding RNA processing." Cell 113:919-933.12837249
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Granneman, S., Nandineni, M. R., Baserga, S. J. (2005). "The putative NTPase Fap7 mediates cytoplasmic 20S pre-rRNA processing through a direct interaction with Rps14." Mol Cell Biol 25:10352-10364.16287850
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956