You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial holo-[acyl-carrier-protein] synthase
Synonyms
  • Mitochondrial holo-ACP synthase
  • 4'-phosphopantetheinyl transferase PPT2
  • PPTase
Gene NamePPT2
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionTransfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of mitochondrial acyl-carrier-protein
Cellular LocationMitochondrion (Probable)
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pantothenate and CoA biosynthesisec00770 Map00770
SMPDB ReactionsNot Available
KEGG Reactions
water + Coenzyme AAdenosine 3',5'-diphosphate + Pantetheine 4'-phosphate + hydron
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00308Pantetheine 4'-phosphateShow
YMDB00349Adenosine 3',5'-diphosphateShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
mitochondrion
Function
magnesium ion binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, for other substituted phosphate groups
holo-[acyl-carrier-protein] synthase activity
binding
ion binding
cation binding
metal ion binding
Process
organic acid metabolic process
oxoacid metabolic process
metabolic process
carboxylic acid metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
monocarboxylic acid metabolic process
biosynthetic process
fatty acid metabolic process
cellular metabolic process
fatty acid biosynthetic process
post-translational protein modification
macromolecule biosynthetic process
protein-cofactor linkage
Gene Properties
Chromosome Locationchromosome 16
LocusYPL148C
Gene Sequence>534 bp ATGCCTCCAGTGATGAGTTTTGCATCGAGGAATATTGGACGTAAGATAGCAGGAGTGGGA GTTGACATTGTATACTTGCCAAGATTTGCACATATACTAGAGAAATATTCCCCATTCGAC CCATGTGGCCGTTCTACCTTGAATAAAATAACACGGAAGTTCATGCATGAAAAGGAAAGA TTTCATTTCAGTAATCTTCTCATCGAAGAAAACTGCTTAACTCCACGATTGCATGAATAT ATAGCGGGAGTTTGGGCTTTGAAGGAATGCTCATTGAAAGCGTTGTGTTGCTGTGTTTCA AAGCATGATCTACCTCCTGCCCAAGTACTGTACGCTGGAATGCTATATAAAACACAAACC GATACAGGTGTACCTCAGTTAGAGTTTGATAAGATGTTTGGAAAAAAGTATCCAAAGTAT CAACAGCTCTCGAAAAACTACGATTCTCTCTTTTCCACTCATGAGTTTTTAGTTTCGCTA TCCCATGATAAAGATTATTTAATTGCAGTAACAAACTTGGTAGAAAGAGAGTAA
Protein Properties
Pfam Domain Function
Protein Residues173
Protein Molecular Weight19973.0
Protein Theoretical pI8.57
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Mitochondrial holo-[acyl-carrier-protein] synthase MSFASRNIGRKIAGVGVDIVYLPRFAHILEKYSPFDPCGRSTLNKITRKFMHEKERFHFS NLLIEENCLTPRLHEYIAGVWALKECSLKALCCCVSKHDLPPAQVLYAGMLYKTQTDTGV PQLEFDKMFGKKYPKYQQLSKNYDSLFSTHEFLVSLSHDKDYLIAVTNLVERE
References
External Links
ResourceLink
Saccharomyces Genome Database PPT2
Uniprot IDQ12036
Uniprot NamePPT2_YEAST
GenBank Gene IDAY558134
Genebank Protein ID45270158
General Reference
  • Stuible, H. P., Meier, S., Wagner, C., Hannappel, E., Schweizer, E. (1998). "A novel phosphopantetheine:protein transferase activating yeast mitochondrial acyl carrier protein." J Biol Chem 273:22334-22339.9712852
  • Purnelle, B., Coster, F., Goffeau, A. (1996). "The sequence of 55 kb on the left arm of yeast chromosome XVI identifies a small nuclear RNA, a new putative protein kinase and two new putative regulators." Yeast 12:1483-1492.8948103
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Kellis, M., Patterson, N., Endrizzi, M., Birren, B., Lander, E. S. (2003). "Sequencing and comparison of yeast species to identify genes and regulatory elements." Nature 423:241-254.12748633
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106