You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial 2-methylisocitrate lyase
Synonyms
  • Methylisocitrate lyase
Gene NameICL2
Enzyme Class
Biological Properties
General FunctionInvolved in isocitrate lyase activity
Specific FunctionCatalyzes the formation of pyruvate and succinate from 2-methylisocitrate during the metabolism of endogenous propionyl- CoA. Does not act on isocitrate
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG Pathways
Propanoate metabolismec00640 Map00640
SMPDB ReactionsNot Available
KEGG Reactions
Methylisocitric acidPyruvic acid + Succinic acid
Metabolites
YMDB IDNameView
YMDB00094Methylisocitric acidShow
YMDB00175Pyruvic acidShow
YMDB00338Succinic acidShow
YMDB00535(2S,3R)-3-hydroxybutane-1,2,3-tricarboxylic acidShow
GO Classification
Component
Not Available
Function
lyase activity
carbon-carbon lyase activity
isocitrate lyase activity
catalytic activity
oxo-acid-lyase activity
Process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR006C
Gene Sequence>1728 bp ATGATTACAATGATTAACAACAAAACTTTCAATAGAAAAACTACGGGAACACTGAAGAAG CTGGTTTTGTCATCAGACAAGTCACTGCGAAGATCTTTCAACGGGGCAAGCAGTACTAAA GACTTCGTGTTCTCGGAATCAAGTAAAGTAGAAGAATGGTGGGAATCAGCCAGATTTAAG AATATCAGTCGTCCATACTCAGCTACGGATGTTGTAAAGCATCGGGGCAGCCTTCCTGCT AATACTTCAATTTATCCTTCATCTTATCAAGCTCGAAAGCTGTTCAACTTACTAGAAGAG AATTTCAAGAATGGTACTCCACTTCACACGTTGGGAGTTATCGATCCTGTACAAATGAGT CAGTTGGCCCGTTGCAGAAATATCAAAGTTGCTTACATATCTGGTTGGGCTTGTTCTTCC ACATTAGTTGGATCTACAAATGAAGTATCGCCGGATTTTGGCGATTATCCATACGATACT GTGCCGAATCAAGTGGAGAGAATATTCAAGGCGCAGCAATTGCACGATCGAAAGGCTTTC TTGGAGGCCTCCATCAAAGGTTCTACTCCTGTTGATTATTTAAAACCAATTATCGCGGAC GCAGACATGGGTCACGGTGGCCCAACGACTGTAATGAAAGTTGCTAAGTTGTTTGCGGAG AAAGGGGCTGCTGGTATTCATCTTGAAGATCAGATGGTGGGAGGCAAAAGGTGTGGCCAT CTAAGTGGGGCTGTTTTGGTGCCCACAGCAACACATCTTATGAGATTGATTTCCACCAGG TTTCAATGGGATATCATGGGGACAGAAAATTTGGTTATTGCAAGAACAGATTCCTGTAAT GGTAAGCTGTTGAGTTCAAGCAGTGATCCGAGAGACCACGAATTCATTAGGGGTATAATA AGAGATAACGTGGTGCCTTGGAGCGAAAAATTGATTGAGATGGAGGACAAAAAAATTCCC AACTCCGCCATTGCTGACATGGAAAAAGAATGGTACCATGAAAATGAGCTGTTTACATTT GAAGAGGCCTTAGAAAAGCAGTTTACGGCAAGCGAGTTTGAAAGCTATAAAGAAAAGAAG GAAGACCTTATGGTAAACAAGCTGGGTAGAGCATACCTAAGCTTAAGAGAAATGAAACTT TTAGCTCAAGAAGTGACACCACTAAAGAAAATTATATTTGACTGGGATGCTCCGAGGACC AAAGAGGGATATTACATGTTTAACGGTTGTATTGAAGCAGCTATTAGAAGATCTTTGGTG TTTGCCCCATATTCTGATATGATTTGGCTGGAAACGAAAACTCCTGACCTGGAGCAGGCA CGCTCATTTTCAAGAAAAATTCATAAACAACTTCCAGCTACCAAGCTAGTATATAACTTA TCTCCTAGTTTCAATTGGAGCGCTCACGGCTTTGATGATAAGGCATTAAAATCCTTCGTA TGGGACTTGGCAAAAGAAGGCTTCACGTTGCAACTGGTTTCCCTTGCCGGTCTGCATTCA GATGGAGTATCATTCTGGGAATTAGCCAATAGCTTCCAAAGTGACGGAATGAAAGCATAC GTCGAAAAAGTGCAAAAACGGGAAAAGGAGACTAATTGTGATATCATGACACACCAGCTA TGGTCTGGTGCAGAATATGTTGATTCCTTAATGAAAGTTGTCCAAAACGGTGCTTCATCC CAAACTTTAAGTACATCTGGTGAGAGCTTTACCGAAACGCAATTTTGA
Protein Properties
Pfam Domain Function
Protein Residues575
Protein Molecular Weight64975.39844
Protein Theoretical pI7.63
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Mitochondrial 2-methylisocitrate lyase MITMINNKTFNRKTTGTLKKLVLSSDKSLRRSFNGASSTKDFVFSESSKVEEWWESARFK NISRPYSATDVVKHRGSLPANTSIYPSSYQARKLFNLLEENFKNGTPLHTLGVIDPVQMS QLARCRNIKVAYISGWACSSTLVGSTNEVSPDFGDYPYDTVPNQVERIFKAQQLHDRKAF LEASIKGSTPVDYLKPIIADADMGHGGPTTVMKVAKLFAEKGAAGIHLEDQMVGGKRCGH LSGAVLVPTATHLMRLISTRFQWDIMGTENLVIARTDSCNGKLLSSSSDPRDHEFIRGII RDNVVPWSEKLIEMEDKKIPNSAIADMEKEWYHENELFTFEEALEKQFTASEFESYKEKK EDLMVNKLGRAYLSLREMKLLAQEVTPLKKIIFDWDAPRTKEGYYMFNGCIEAAIRRSLV FAPYSDMIWLETKTPDLEQARSFSRKIHKQLPATKLVYNLSPSFNWSAHGFDDKALKSFV WDLAKEGFTLQLVSLAGLHSDGVSFWELANSFQSDGMKAYVEKVQKREKETNCDIMTHQL WSGAEYVDSLMKVVQNGASSQTLSTSGESFTETQF
References
External Links
ResourceLink
Saccharomyces Genome Database ICL2
Uniprot IDQ12031
Uniprot NameACEB_YEAST
GenBank Gene IDZ48951
Genebank Protein ID763005
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Heinisch, J. J., Valdes, E., Alvarez, J., Rodicio, R. (1996). "Molecular genetics of ICL2, encoding a non-functional isocitrate lyase in Saccharomyces cerevisiae." Yeast 12:1285-1295.8923733
  • Luttik, M. A., Kotter, P., Salomons, F. A., van der Klei, I. J., van Dijken, J. P., Pronk, J. T. (2000). "The Saccharomyces cerevisiae ICL2 gene encodes a mitochondrial 2-methylisocitrate lyase involved in propionyl-coenzyme A metabolism." J Bacteriol 182:7007-7013.11092862
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278