You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA (guanine-N(7)-)-methyltransferase
Synonyms
  • Transfer RNA methyltransferase 8
  • tRNA(m7G46)-methyltransferase
Gene NameTRM8
Enzyme Class
Biological Properties
General FunctionInvolved in tRNA (guanine-N7-)-methyltransferase activity
Specific FunctionMethyltransferase that catalyzes the formation of N(7)- methylguanine at position 46 (m7G46) in tRNA, a modification required to maintain stability of tRNAs; its absence resulting in tRNA decay. Both the D-stem and T-stem structures of tRNAs are required for efficient methyltransferase activity
Cellular LocationNucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
GO Classification
Component
Not Available
Function
RNA methyltransferase activity
tRNA methyltransferase activity
tRNA (guanine) methyltransferase activity
tRNA (guanine-N7-)-methyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Process
tRNA modification
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA processing
Gene Properties
Chromosome Locationchromosome 4
LocusYDL201W
Gene Sequence>861 bp ATGAAAGCCAAGCCACTAAGCCAAGATCCAGGCTCCAAGCGTTACGCATACCGTATAAAT AAGGAAGAAAATCGTAAGGAGTTGAAGCATGTAAAGATCAATGAAAGTTCTTTGGTGCAA GAAGGCCAAAAGATCGACTTGCCAAAGAAGAGATATTATCGTCAAAGGGCGCATTCCAAC CCATTTTCAGATCACCAGTTAGAGTACCCAGTATCTCCCCAGGATATGGATTGGTCCAAA TTGTACCCTTACTACAAAAACGCGGAAAATGGACAAATGACAAAGAAGGTGACGATTGCT GATATTGGCTGTGGATTCGGTGGGTTGATGATAGATTTATCACCAGCCTTCCCTGAAGAT CTTATCTTAGGGATGGAAATTCGTGTGCAGGTTACAAATTACGTGGAGGATAGAATTATT GCCTTAAGGAACAATACAGCTTCAAAACATGGATTTCAAAACATTAATGTCTTGAGAGGT AACGCTATGAAATTCTTGCCCAACTTTTTTGAAAAGGGCCAGCTTTCTAAAATGTTTTTT TGTTTCCCCGATCCTCATTTCAAACAAAGAAAGCATAAGGCAAGAATTATCACTAACACC TTGCTGAGTGAGTACGCATATGTTTTGAAAGAGGGCGGTGTCGTGTACACAATTACAGAC GTCAAAGACCTGCATGAGTGGATGGTAAAACATTTAGAAGAGCATCCTTTATTTGAACGG TTGAGCAAAGAATGGGAAGAAAACGATGAATGTGTGAAAATAATGAGAAATGCCACAGAA GAAGGTAAAAAAGTGGAAAGAAAGAAGGGTGACAAGTTCGTCGCTTGTTTCACAAGATTA CCAACGCCAGCCATATTGTAA
Protein Properties
Pfam Domain Function
Protein Residues286
Protein Molecular Weight33391.19922
Protein Theoretical pI9.56
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA (guanine-N(7)-)-methyltransferase MKAKPLSQDPGSKRYAYRINKEENRKELKHVKINESSLVQEGQKIDLPKKRYYRQRAHSN PFSDHQLEYPVSPQDMDWSKLYPYYKNAENGQMTKKVTIADIGCGFGGLMIDLSPAFPED LILGMEIRVQVTNYVEDRIIALRNNTASKHGFQNINVLRGNAMKFLPNFFEKGQLSKMFF CFPDPHFKQRKHKARIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKHLEEHPLFER LSKEWEENDECVKIMRNATEEGKKVERKKGDKFVACFTRLPTPAIL
References
External Links
ResourceLink
Saccharomyces Genome Database TRM8
Uniprot IDQ12009
Uniprot NameTRMB_YEAST
GenBank Gene IDX99000
Genebank Protein ID1429356
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Alexandrov, A., Martzen, M. R., Phizicky, E. M. (2002). "Two proteins that form a complex are required for 7-methylguanosine modification of yeast tRNA." RNA 8:1253-1266.12403464
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Alexandrov, A., Grayhack, E. J., Phizicky, E. M. (2005). "tRNA m7G methyltransferase Trm8p/Trm82p: evidence linking activity to a growth phenotype and implicating Trm82p in maintaining levels of active Trm8p." RNA 11:821-830.15811913
  • Alexandrov, A., Chernyakov, I., Gu, W., Hiley, S. L., Hughes, T. R., Grayhack, E. J., Phizicky, E. M. (2006). "Rapid tRNA decay can result from lack of nonessential modifications." Mol Cell 21:87-96.16387656
  • Matsumoto, K., Toyooka, T., Tomikawa, C., Ochi, A., Takano, Y., Takayanagi, N., Endo, Y., Hori, H. (2007). "RNA recognition mechanism of eukaryote tRNA (m7G46) methyltransferase (Trm8-Trm82 complex)." FEBS Lett 581:1599-1604.17382321
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Leulliot, N., Chaillet, M., Durand, D., Ulryck, N., Blondeau, K., van Tilbeurgh, H. (2008). "Structure of the yeast tRNA m7G methylation complex." Structure 16:52-61.18184583