You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameEnolase-related protein 1/2
Synonyms
  • 2-phospho-D-glycerate hydro-lyase
  • 2-phosphoglycerate dehydratase
Gene NameERR1
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific Function2-phospho-D-glycerate = phosphoenolpyruvate + H(2)O
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Glycolysis / Gluconeogenesisec00010 Map00010
Methane metabolismec00680 Map00680
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00276Phosphoenolpyruvic acidShow
YMDB006752-phospho-D-glyceric acidShow
YMDB00890waterShow
YMDB009852-phospho-d-glycerateShow
GO Classification
Component
phosphopyruvate hydratase complex
macromolecular complex
protein complex
Function
ion binding
cation binding
metal ion binding
magnesium ion binding
carbon-oxygen lyase activity
hydro-lyase activity
catalytic activity
lyase activity
phosphopyruvate hydratase activity
binding
Process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
metabolic process
glycolysis
Gene Properties
Chromosome Locationchromosome 15
LocusYOR393W
Gene Sequence>1314 bp ATGTCCATCACGAAGGTACATGCTAGAACGGTGTATGATTCTCGCGGCAATCCGACTGTT GAGGTTGAAATTACAACAGAGAATGGTCTCTTCAGAGCGATCGTCCCATCTGGTGCCTCC ACCGGCATTCACGAAGCTGTTGAACTTAGAGACGGGAACAAGTCCGAATGGATGGGAAAA GGGGTGACCAAGGCAGTCAGTAACGTCAATAGTATCATAGGGCCTGCTTTAATCAAGTCC GAATTATGTGTAACCAATCAGAAGGGCATAGACGAGCTCATGATATCGTTAGACGGAACT TCTAACAAGTCAAGGTTGGGCGCCAATGCTATCCTTGGTGTTTCCTTGTGCGTTGCTCGA GCTGCTGCCGCACAAAAGGGAATTACTCTCTACAAGTATATAGCCGAGTTAGCGGATGCT AGACAGGACCCCTTTGTTATTCCTGTTCCTTTTTTCAATGTTTTGAATGGTGGAGCCCAC GCCGGTGGCTCTTTAGCTATGCAAGAATTCAAGATCGCGCCAGTCGGGGCTCAGAGCTTT GCAGAAGCCATGAGGATGGGTTCGGAAGTTTACCATCATTTGAAGATATTGGCGAAGGAG CAATATGGACCTTCCGCTGGAAATGTTGGTGACGAGGGTGGAGTTGCCCCCGATATTGAC ACTGCCGAAGACGCCTTGGACATGATTGTGGAAGCCATTAACATATGCGGTTACGAGGGT AGAGTGAAAGTAGGAATCGATAGTGCTCCTTCTGTTTTTTATAAGGACGGGAAATACGAC CTAAATTTCAAGGAACCGAACTCTGACCCATCTCACTGGCTCAGTCCAGCCCAGTTAGCA GAATATTACCATTCATTGCTAAAGAAATACCCAATCATTTCCCTGGAAGATCCCTACGCC GAAGATGATTGGTCCTCGTGGTCTGCCTTCCTAAAGACTGTCAATGTTCAGATTATTGCA GATGACCTGACATGCACCAACAAGACCAGGATCGCCCGTGCTATAGAGGAGAAATGTGCG AATACTCTGTTGCTGAAACTCAACCAGATCGGTACTCTGACTGAGTCTATTGAAGCCGCC AATCAGGCTTTCGATGCTGGATGGGGTGTAATGATATCGCATAGATCAGGTGAAACCGAA GATCCGTTTATCGCTGATTTGGTCGTTGGTTTAAGATGTGGTCAAATTAAATCGGGCGCT TTGTCGAGATCAGAAAGACTGGCCAAGTATAATGAACTTTTGCGTATCGAAGAGGAACTG GGGGACGATTGTATATATGCTGGTCATAGGTTTCATGATGGAAACAAACTATAA
Protein Properties
Pfam Domain Function
Protein Residues437
Protein Molecular Weight47327.10156
Protein Theoretical pI4.94
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Enolase-related protein 1/2 MSITKVHARTVYDSRGNPTVEVEITTENGLFRAIVPSGASTGIHEAVELRDGNKSEWMGK GVTKAVSNVNSIIGPALIKSELCVTNQKGIDELMISLDGTSNKSRLGANAILGVSLCVAR AAAAQKGITLYKYIAELADARQDPFVIPVPFFNVLNGGAHAGGSLAMQEFKIAPVGAQSF AEAMRMGSEVYHHLKILAKEQYGPSAGNVGDEGGVAPDIDTAEDALDMIVEAINICGYEG RVKVGIDSAPSVFYKDGKYDLNFKEPNSDPSHWLSPAQLAEYYHSLLKKYPIISLEDPYA EDDWSSWSAFLKTVNVQIIADDLTCTNKTRIARAIEEKCANTLLLKLNQIGTLTESIEAA NQAFDAGWGVMISHRSGETEDPFIADLVVGLRCGQIKSGALSRSERLAKYNELLRIEEEL GDDCIYAGHRFHDGNKL
References
External Links
ResourceLink
Saccharomyces Genome Database ERR1
Uniprot IDQ12007
Uniprot NameERR1_YEAST
GenBank Gene IDZ73637
Genebank Protein ID1370578
General Reference
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Pryde, F. E., Huckle, T. C., Louis, E. J. (1995). "Sequence analysis of the right end of chromosome XV in Saccharomyces cerevisiae: an insight into the structural and functional significance of sub-telomeric repeat sequences." Yeast 11:371-382.7785338