You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLeukotriene A-4 hydrolase
Synonyms
  • LTA-4 hydrolase
  • Leukotriene A(4) hydrolase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in binding
Specific FunctionHydrolyzes an epoxide moiety of LTA(4) to form LTB(4). The enzyme also has aminopeptidase activity
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Arachidonic acid metabolismec00590 Map00590
SMPDB ReactionsNot Available
KEGG Reactions
leukotriene A4 + water(5S,6S)-di-HETE
leukotriene A4 + waterDelta(6)-trans,Delta(8)-cis-leukotriene B4
leukotriene A4 + waterleukotriene B4
Metabolites
YMDB IDNameView
YMDB00264leukotriene A4Show
YMDB00728(5S,6S)-di-HETEShow
YMDB00729Delta(6)-trans,Delta(8)-cis-leukotriene B4Show
YMDB00730leukotriene B4Show
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity, acting on ether bonds
peptidase activity
peptidase activity, acting on L-amino acid peptides
binding
metallopeptidase activity
ion binding
ether hydrolase activity
cation binding
leukotriene-A4 hydrolase activity
metal ion binding
transition metal ion binding
zinc ion binding
hydrolase activity
catalytic activity
Process
metabolic process
macromolecule metabolic process
protein metabolic process
cellular metabolic process
proteolysis
unsaturated fatty acid metabolic process
icosanoid metabolic process
leukotriene metabolic process
leukotriene biosynthetic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
fatty acid metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYNL045W
Gene Sequence>2016 bp ATGTTCTTGCTTCCATTTGTCATTCGTCATTCCAGCTCTATTTACCTGCCCACGCTTCGA TTTCGAGGTTTACTTACTGTAATCTCAAGAAACATACACATTTCCACCCCTCATAAAATG TTGCCTCTTTCAATTGAGCAGAGAAGACCTTCCCGCTCCCCCGAATACGATCAGTCTACT TTATCAAATTATAAGGACTTCGCAGTTCTTCACACCGATTTAAACCTGTCTGTTTCCTTC GAAAAGTCAGCCATTTCAGGGAGCGTTACATTCCAATTGAAAAAACTGCACGAAGGTAAA AATAAATCGGATGAATTACATCTGGATACATCCTATTTGGATGTCCAGGAGGTTCATATT GATGGTTCCAAGGCAGATTTTCAAATTGAGCAAAGAAAGGAGCCATTGGGCTCCAGGTTA GTCATCAATAACGCTTCTTGCAACGATAACTTTACCTTGAATATTCAATTTCGTACGACT GACAAGTGCACCGCTTTGCAATGGTTGAACAGCAAGCAAACCAAGGGCGGTAAACCGTAC GTGTTTTCACAGTTGGAAGCTATTCATGCGAGGTCTTTGTTCCCCTGCTTTGATACTCCC TCTGTGAAGTCTACTTTCACTGCATCTATCGAGTCCCCACTACCAGTGGTTTTTTCAGGC ATCAGGATTGAAGATACAAGCAAGGATACTAATATTTACAGATTTGAACAGAAAGTCCCT ATCCCAGCCTACCTGATCGGTATTGCTTCCGGTGATTTGTCAAGCGCTCCAATTGGACCT CGTTCCACAGTTTACACTGAACCATTTCGTTTGAAAGATTGTCAATGGGAATTTGAAAAC GATGTAGAGAAATTCATTCAAACTGCAGAGAAAATTATCTTTGAATACGAGTGGGGCACT TATGATATCTTAGTTAACGTCGATTCGTACCCTTACGGCGGTATGGAGTCTCCGAATATG ACTTTTGCTACGCCCACCTTGATTGCACATGACAGATCCAACATTGATGTCATCGCCCAT GAACTTGCTCACTCATGGTCTGGTAACTTAGTGACCAATTGTTCGTGGAATCATTTTTGG TTGAATGAAGGTTGGACCGTTTACTTAGAAAGAAGAATTATTGGTGCCATTCATGGCGAA CCAACTAGACATTTCAGTGCTCTGATTGGTTGGAGCGATTTGCAGAATTCTATTGATTCT ATGAAAGATCCTGAAAGATTTTCCACTTTGGTACAAAACTTGAACGATAACACTGACCCT GACGATGCCTTTTCCACTGTTCCGTACGAAAAGGGGTTCAACTTACTATTTCACTTGGAA ACTATTTTGGGTGGTAAGGCTGAATTTGATCCATTTATTAGACACTATTTCAAGAAGTTT GCCAAAAAATCATTGGATACTTTCCAGTTTTTGGATACTTTGTATGAGTTCTATCCCGAA AAGAAAGAAATTTTGGATTCCGTTGACTGGGAAACTTGGCTGTATAAACCAGGTATGCCA CCAAGGCCTCATTTTATTACGGCTTTGGCTGATAATGTTTATCAATTGGCTGACAAGTGG GTCGAAATGGCTCAACATTTGAAAACCACAGAGGATTTCCGGTCTGAATTTAACGCTATT GACATTAAGGATTTTAATTCAAATCAATTGGTTTTGTTCTTGGAAACTTTGACACAAAAT GGCCATTCCAACAAGAAACCAAAAGATTTTGACTGGGCCAAGTTTCCCGTGGCATCTAGG GCACTGTTAGATATCTATCAAGATAACATTGTTAAATCACAGAACGCGGAAGTTGTTTTC AAGATGTTCAAATTTCAGATCTTTGCCAAGCTGCAAGAAGAATATAAGCATTTGGCCGAT TGGTTGGGAACTGTAGGTAGAATGAAGTTTGTCCGTCCCGGTTACAGACTATTAAACTCT GTAGACCGTCGATTGGCACTTGCAACTTTCGACAAATTCAAGGACACGTATCATCCAATC TGTAAAGCTCTTGTGAAACAAGATTTAGGTCTTTGA
Protein Properties
Pfam Domain Function
Protein Residues671
Protein Molecular Weight77352.10156
Protein Theoretical pI6.55
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Leukotriene A-4 hydrolase MFLLPFVIRHSSSIYLPTLRFRGLLTVISRNIHISTPHKMLPLSIEQRRPSRSPEYDQST LSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEGKNKSDELHLDTSYLDVQEVHI DGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPY VFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTSKDTNIYRFEQKVP IPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGT YDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFW LNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDP DDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPE KKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAI DIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVF KMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPI CKALVKQDLGL
References
External Links
ResourceLink
Saccharomyces Genome Database YNL045W
Uniprot IDQ10740
Uniprot NameLKHA4_YEAST
GenBank Gene IDX94547
Genebank Protein ID1149543
General Reference
  • Nasr, F., Becam, A. M., Herbert, C. J. (1996). "The sequence of 12.8 kb from the left arm of chromosome XIV reveals a sigma element, a pro-tRNA and six complete open reading frames, one of which encodes a protein similar to the human leukotriene A4 hydrolase." Yeast 12:493-499.8740423
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Kull, F., Ohlson, E., Haeggstrom, J. Z. (1999). "Cloning and characterization of a bifunctional leukotriene A(4) hydrolase from Saccharomyces cerevisiae." J Biol Chem 274:34683-34690.10574934
  • Kull, F., Ohlson, E., Lind, B., Haeggstrom, J. Z. (2001). "Saccharomyces cerevisiae leukotriene A4 hydrolase: formation of leukotriene B4 and identification of catalytic residues." Biochemistry 40:12695-12703.11601994
  • Andersson, B., Kull, F., Haeggstrom, J. Z., Thunnissen, M. M. (2003). "Crystallization and X-ray diffraction data analysis of leukotriene A4 hydrolase from Saccharomyces cerevisiae." Acta Crystallogr D Biol Crystallogr 59:1093-1095.12777785
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Tholander, F., Kull, F., Ohlson, E., Shafqat, J., Thunnissen, M. M., Haeggstrom, J. Z. (2005). "Leukotriene A4 hydrolase, insights into the molecular evolution by homology modeling and mutational analysis of enzyme from Saccharomyces cerevisiae." J Biol Chem 280:33477-33486.16024909
  • Thompson, M. W., Archer, E. D., Romer, C. E., Seipelt, R. L. (2006). "A conserved tyrosine residue of Saccharomyces cerevisiae leukotriene A4 hydrolase stabilizes the transition state of the peptidase activity." Peptides 27:1701-1709.16597475
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956