You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI21
Synonyms
  • Hydroxymethylpyrimidine kinase
  • HMP kinase
  • Hydroxymethylpyrimidine phosphate kinase
  • HMP-P kinase
  • HMP-phosphate kinase
  • HMPP kinase
Gene NameTHI21
Enzyme Class
Biological Properties
General FunctionInvolved in phosphomethylpyrimidine kinase activity
Specific FunctionCatalyzes the phosphorylation of hydroxymethylpyrimidine phosphate (HMP-P) to HMP-PP, and also probaby that of HMP to HMP- P
Cellular LocationNot Available
SMPDB Pathways
Vitamin B1/Thiamine metabolismPW002486 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Thiamine metabolismec00730 Map00730
SMPDB Reactions
Adenosine triphosphate + 4-amino-5-hydroxymethyl-2-methylpyrimidine4-amino-2-methyl-5-phosphomethylpyrimidine + ADP
Adenosine triphosphate + 4-amino-2-methyl-5-phosphomethylpyrimidineADP + 4-amino-2-methyl-5-diphosphomethylpyrimidine
4-amino-5-hydroxymethyl-2-methylpyrimidine + Adenosine triphosphate ADP + hydron + 4-amino-2-methyl-5-phosphomethylpyrimidine
KEGG Reactions
Adenosine triphosphate + 4-amino-5-hydroxymethyl-2-methylpyrimidine4-amino-2-methyl-5-phosphomethylpyrimidine + hydron + ADP
4-amino-2-methyl-5-phosphomethylpyrimidine + Adenosine triphosphate4-amino-2-methyl-5-diphosphomethylpyrimidine + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB001174-amino-2-methyl-5-diphosphomethylpyrimidineShow
YMDB001184-amino-5-hydroxymethyl-2-methylpyrimidineShow
YMDB001284-amino-2-methyl-5-phosphomethylpyrimidineShow
YMDB00793ToxopyrimidineShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
phosphomethylpyrimidine kinase activity
Process
metabolic process
cellular metabolic process
cellular aromatic compound metabolic process
thiamin and derivative metabolic process
thiamin metabolic process
thiamin biosynthetic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL258C
Gene Sequence>1656 bp ATGACCTATTCTACAGTTAATATTAATACACCTCCACCATATCTCGCTTTGGCCAGCAAT GAAAAATTACCCACAGTTTTGTCTATTGCTGGAACAGATCCAAGCGGTGGTGCTGGTGTT GAAGCAGATGTGAAAACTATCACTGCACACAGATGCTATGCTATGACATGCATCACTGCT TTGAATGCTCAAACTCCAGTTAAAGTATACAGCATTAATAACACGCCAAAGGAAGTAGTT TCCCAAATTTTGGACGCCAATTTACAAGACATGAAATGTGACGTCATCAAGACTGGCATG CTTACGACAGCTGCTATCGAGGTTTTGCACGAAAAACTGCTGCAGCTCGGCGAAAATAGA CCTAAGCTAGTAGTTGACCCAGTCCTTGTTGCTACTTCAGGCTCTTCTTTAGCTGGAAAG GATATAGCCAGTTTAATTACGGAGAAAATCGCACCTTTTGCTGACATTTTGACTCCTAAC ATTCCGGAGTGTTTCAAACTGTTAGGTGAAGACAGAGAAATAAGCAAATTGCGAGACATT TTCGAAGTCGCAAAAGACCTTGCCAAAATCACCAAGTGTTCCAATATTTTGGTTAAAGGT GGTCACATTCCATGGAATGATGAAGAAGGAAAGTACATCACTGATGTCCTTTACTTAGGG GCCGAACAAAGGTTTATAACCTTCAAGGGTAATTTTGTTAATACAACCCACACTCATGGT ACCGGGTGCACCCTAGCTTCCGCCATTGCATCAAATTTGGCTCGCGGTTATTCCCTTCCC CAATCCGTTTATGGCGGTATTGAGTACGTCCAAAATGCGGTGGCCATTGGCTGCGATGTC ACGAAAGAGACTGTTAAGGACAACGGGCCAATTAATCATGTCTACGCCATCGAAATTCCA TTAGAAAAAATGCTCAGTGACGAATGTTTCACTGCATCAGATGCCGTACACAAAAAGCCA GTCAAAAGTTCTCTTAACAAAATCCCTGGAGGAAGTTTCTATAAATATCTGATAAATCAC CCTAAAGTTAAGCCCCACTGGGACTCCTATGTGAACCATGATTTTGTTAGAAAAGTAGCA GACGGTTCCTTAGAGCCTAAGAAGTTCCAATTTTTTATCGAACAAGATTACCTGTACTTA GTCAATTATGCCAGGATTTCCTGCATCGCGGGTAGTAAATCCCCGTGTCTTGAAGACCTG GAGAAAGAGCTAGTTATTGTCGAATGCGTTCGTAATGGGCTTTGCCAACATGAAAGGAGA TTAAGGGAGGAATTTGGAATTAAGGATCCCGACTACTTACAAAAGATTCAAAGAGGTCCT GCATTAAGGGCTTACTGTCGTTACTTTAATGATGTTTCCAGAAGAGGTAACTGGCAGGAG TTAGTTATAGCTCTTAATCCTTGCTTAATGGGCTATGTTCACGCTTTGACCAAGATCAAG GATGAAGTAACTGCAGCAGAAGGCTCCGTTTACCGTGAATGGTGTGAAACTTACTCATCG TCATGGTGCCACGAAGCTATGCTTGAAGGCGAAAAGCTGTTGAATCACATCTTGGAAACA TACCCTCCAGAAAAACTTGATACACTGGTCACAATATATGCTGAAGTTTGTGAATTGGAA GCTAACTTCTGGACCGCCGCTCTAGAATATGAATGA
Protein Properties
Pfam Domain Function
Protein Residues551
Protein Molecular Weight61333.69922
Protein Theoretical pI5.77
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI21 MTYSTVNINTPPPYLALASNEKLPTVLSIAGTDPSGGAGVEADVKTITAHRCYAMTCITA LNAQTPVKVYSINNTPKEVVSQILDANLQDMKCDVIKTGMLTTAAIEVLHEKLLQLGENR PKLVVDPVLVATSGSSLAGKDIASLITEKIAPFADILTPNIPECFKLLGEDREISKLRDI FEVAKDLAKITKCSNILVKGGHIPWNDEEGKYITDVLYLGAEQRFITFKGNFVNTTHTHG TGCTLASAIASNLARGYSLPQSVYGGIEYVQNAVAIGCDVTKETVKDNGPINHVYAIEIP LEKMLSDECFTASDAVHKKPVKSSLNKIPGGSFYKYLINHPKVKPHWDSYVNHDFVRKVA DGSLEPKKFQFFIEQDYLYLVNYARISCIAGSKSPCLEDLEKELVIVECVRNGLCQHERR LREEFGIKDPDYLQKIQRGPALRAYCRYFNDVSRRGNWQELVIALNPCLMGYVHALTKIK DEVTAAEGSVYREWCETYSSSWCHEAMLEGEKLLNHILETYPPEKLDTLVTIYAEVCELE ANFWTAALEYE
References
External Links
ResourceLink
Saccharomyces Genome Database THI21
Uniprot IDQ08975
Uniprot NameTHI21_YEAST
GenBank Gene IDZ73614
Genebank Protein ID1370532
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Llorente, B., Fairhead, C., Dujon, B. (1999). "Genetic redundancy and gene fusion in the genome of the Baker's yeast Saccharomyces cerevisiae: functional characterization of a three-member gene family involved in the thiamine biosynthetic pathway." Mol Microbiol 32:1140-1152.10383756