You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFolylpolyglutamate synthase
Synonyms
  • Folylpoly-gamma-glutamate synthetase
  • FPGS
  • Tetrahydrofolylpolyglutamate synthase
  • Tetrahydrofolate synthase
Gene NameMET7
Enzyme Class
Biological Properties
General FunctionCoenzyme transport and metabolism
Specific FunctionConversion of folates to polyglutamate derivatives
Cellular LocationMitochondrion. Cytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Folate biosynthesisec00790 Map00790
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + 5,6,7,8-Tetrahydrofolic acid + L-Glutamic acidphosphate + 5,6,7,8-tetrahydrofolyl-L-glutamic acid + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00271L-Glutamic acidShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB007735,6,7,8-tetrahydrofolyl-L-glutamic acidShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
catalytic activity
adenyl ribonucleotide binding
ATP binding
ligase activity
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
tetrahydrofolylpolyglutamate synthase activity
Process
cellular metabolic process
folic acid and derivative biosynthetic process
metabolic process
cellular aromatic compound metabolic process
biosynthetic process
folic acid and derivative metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR241W
Gene Sequence>1647 bp ATGCATAAAGGAAAAAAAAATTACCCTAATTTGATTACTTCGTTTCGGATGAATTTGAAA AAAATCATATTGAACCATGACCGATTTAGCCATCCAGAAAGATGGAAAACAAACGCACTC TTAAGGTTCACCTTCGTGTATATAAAATTTCTCTTCGACTTGATGATAATCAAAAATCCA TTAAGGATGGTTGGAAAAACTTATCGAGACGCTGTTACTGCGCTAAACTCTTTGCAGTCC AATTATGCCAACATCATGGCTATCCGTCAAACTGGTGATCGTAAAAACACTATGACATTA TTGGAAATGCATGAATGGTCTCGAAGAATTGGTTACTCTGCATCGGATTTCAATAAATTA AATATTGTTCATATCACTGGAACAAAAGGTAAAGGTTCTACTGCCGCATTTACTTCATCA ATTCTAGGACAATATAAAGAACAATTACCACGTATCGGGCTATATACGTCTCCACATCTT AAGTCAGTGAGAGAAAGAATAAGAATAAATGGGGAGCCAATTTCTGAAGAAAAATTTGCG AAGTACTTCTTTGAGGTTTGGGACCGTCTAGATAGTACAACCTCTTCTTTGGATAAATTC CCGCACATGATCCCGGGAAGTAAGCCTGGCTATTTCAAGTTCCTCACATTGCTTTCATTT CACACTTTTATACAAGAGGACTGCAAAAGCTGTGTCTACGAAGTCGGCGTCGGAGGTGAA TTGGATAGCACTAATATAATTGAAAAGCCAATTGTCTGCGGTGTTACACTATTAGGAATA GACCATACTTTCATGCTTGGTGATACTATTGAAGAAATTGCTTGGAATAAGGGAGGAATT TTCAAATCTGGAGCACCAGCATTCACCGTTGAGAAACAACCTCCTCAGGGATTAACAATA TTGAAAGAAAGAGCTGAGGAGCGCAAAACAACGCTAACAGAAGTACCCCCATTTAAACAG TTGGAAAATGTCAAGCTTGGAATTGCTGGCGAGTTTCAAAAAAGTAACGCCTCCCTTGCC GTTATGCTGGCTTCTGAGATCTTGCATACGTCCAATATATTGGAGGAGAAGATCAAATGC AGTTCGAATGCATCGATTCCAGAAAAATTCATAATCGGTCTACAAAATACTAAGTGGGAA GGCAGATGTCAAGTACTAGAAAAGGGAAAAAACGTTTGGTACATTGATGGTGCTCACACC AAAGATAGTATGGTAGCTGCATCAACATGGTTCAGAGATATGGTTCGATTGTCGAAGAGA AAGAAGATCTTGCTCTTCAACCAACAAAGCAGAGATGCCAACGCTCTTGTGAATAACCTG TACTCATCTGTTTCGCCAGAAATAACGTTCGATGATGTGATATTTACTACTAATGTCACT TGGAAATCAGGCTCATACAGCGCTGACCTCGTTTCCATGAACACTTCTCAAGAAGATGTA GAAAAATTGAAAGTCCAGGAGTCATTAGTCAAGAATTGGAACAAAATAGACGATAATCGT GCTAAAACGCATGTAACGGCTAGTATAGAGGAAGCAAATGAATTGATTGAAACGCTATAC GATGAACCTGCTGATATATTTGTAACTGGTTCATTACATCTTGTTGGCGGATTATTGGTC GTTTTTGATAGAATAGATGTAAAGTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues548
Protein Molecular Weight62150.89844
Protein Theoretical pI9.24
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Folylpolyglutamate synthase MHKGKKNYPNLITSFRMNLKKIILNHDRFSHPERWKTNALLRFTFVYIKFLFDLMIIKNP LRMVGKTYRDAVTALNSLQSNYANIMAIRQTGDRKNTMTLLEMHEWSRRIGYSASDFNKL NIVHITGTKGKGSTAAFTSSILGQYKEQLPRIGLYTSPHLKSVRERIRINGEPISEEKFA KYFFEVWDRLDSTTSSLDKFPHMIPGSKPGYFKFLTLLSFHTFIQEDCKSCVYEVGVGGE LDSTNIIEKPIVCGVTLLGIDHTFMLGDTIEEIAWNKGGIFKSGAPAFTVEKQPPQGLTI LKERAEERKTTLTEVPPFKQLENVKLGIAGEFQKSNASLAVMLASEILHTSNILEEKIKC SSNASIPEKFIIGLQNTKWEGRCQVLEKGKNVWYIDGAHTKDSMVAASTWFRDMVRLSKR KKILLFNQQSRDANALVNNLYSSVSPEITFDDVIFTTNVTWKSGSYSADLVSMNTSQEDV EKLKVQESLVKNWNKIDDNRAKTHVTASIEEANELIETLYDEPADIFVTGSLHLVGGLLV VFDRIDVK
References
External Links
ResourceLink
Saccharomyces Genome Database MET7
Uniprot IDQ08645
Uniprot NameFOLE_YEAST
GenBank Gene IDAY692818
Genebank Protein ID51013087
General Reference
  • Boyer, J., Michaux, G., Fairhead, C., Gaillon, L., Dujon, B. (1996). "Sequence and analysis of a 26.9 kb fragment from chromosome XV of the yeast Saccharomyces cerevisiae." Yeast 12:1575-1586.8972580
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Cherest, H., Thomas, D., Surdin-Kerjan, Y. (2000). "Polyglutamylation of folate coenzymes is necessary for methionine biosynthesis and maintenance of intact mitochondrial genome in Saccharomyces cerevisiae." J Biol Chem 275:14056-14063.10799479
  • DeSouza, L., Shen, Y., Bognar, A. L. (2000). "Disruption of cytoplasmic and mitochondrial folylpolyglutamate synthetase activity in Saccharomyces cerevisiae." Arch Biochem Biophys 376:299-312.10775416
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106