You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameATP-dependent permease AUS1
SynonymsNot Available
Gene NameAUS1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionTransporter involved in the uptake of sterol
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00262LanosterinShow
YMDB00540episterolShow
YMDB00543ergosterolShow
YMDB0054524-methylidene-5alpha-cholest-8-en-3beta-olShow
YMDB00547lanosterolShow
YMDB00548zymosterolShow
GO Classification
Component
integral to membrane
cell part
membrane
membrane part
intrinsic to membrane
Function
primary active transmembrane transporter activity
P-P-bond-hydrolysis-driven transmembrane transporter activity
binding
ATPase activity, coupled to transmembrane movement of substances
nucleoside binding
pyrophosphatase activity
purine nucleoside binding
nucleoside-triphosphatase activity
adenyl nucleotide binding
ATPase activity
adenyl ribonucleotide binding
ATP binding
nucleotide binding
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
catalytic activity
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
Process
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 15
LocusYOR011W
Gene Sequence>4185 bp ATGTCAATTTCAAAGTACTTCACTCCCGTTGCTGACGGGTCACTCACTTTCAATGGCGCG AACATTCAATTTGGCGCCGATGCTCAAGGCGAGTCAAAAAAGAGTTATGACGCTGAGGAC AGCATGCCGAATCCGGCAAATCAACTAAATGACATAACCTTCCAAGCAGAGGCTGGTGAA ATGGTTTTGGTTTTGGGTTATCCCACATCCACTCTATTTAAGACTTTGTTTCATGGTAAA ACTAGTTTGTCATACTCTCCTCCAGGCTCGATTAAATTTAAAAATAATGAGTTTAAGAGC TTTTCCGAAAAATGTCCCCACCAAATCATTTACAATAATGAACAAGATGTGCATTTCCCA TTTCTAACGGTAGAACAAACAATTGATTTTGCCTTGAGTTGTAAGTTCGATATTCCAAAA GGTGAGCGCGATCAAATAAGAAATGAACTTCTAAGAGAATTCGGCCTGTCTCATGTATTG AAAACTATTGTAGGAAATGATTTTTTCCGTGGTGTTTCTGGTGGTGAGCGTAAACGTATT TCTATTATTGAAACGTTTATTGCTAATGGTTCCGTTTATCTATGGGATAATTCTACTAAA GGTTTAGATTCCGCCACAGCTCTCGATTTTTTGGAAATTCTTAGAAAAATGGCAAAAGCT ACTCGTTCTGTAAACTTAGTCAGAATTTCCCAGGCAAGTGATAAAATTGTTGATAAGTTT GACAAGATTCTTATGCTATCCGATTCCTACCAGCTTTTCTATGGTACGGTCGATGAGTGT TTGACTTATTTTCGTGACACTTTAGGTATTGAGAAAGATCCTAACGATTGTATTATTGAA TATCTGACCTCTATCTTAAATTTTCAGTTCAAAAATAAAAATTTGGGGAATTTATCAAAT TCATCATCTGCTAGCGTTCTCAAAACCGCAACAGGGGAAGTCACTAAGTATACTTATAAT TCTGATTTCGATTTATATGATCAATGGAAACATTCTTCGTACTATAGAAATATAAAGCAG CAAATCCAGGGGTCTTCAATTGATGACTCCATTAAGGAAGTGGATCCCTCTGATGTCTCA CCTATTTTTAATATTCCGTTGAAGAAACAATTATTATTTTGCACAAAAAGAGCTTTTCAA CGAAGTTTGGGTGATAAAGCTTATATGACGGCACAATTTATTTCTGTCGTTATTCAATCT TTGGTCATTGGTTCACTGTTTTACGAAATTCCGTTGACTACCATTGGTTCATACTCAAGA GGTTCTTTAACCTTTTTCTCCATTCTTTTCTTCACTTTTCTTTCTCTTGCAGATATGCCT ATTGCCTTCCAAAGACAACCCGTCGTTAAAAAGCAATCCCAACTTCACTTCTATACTAAC TGGGTTGAAACCCTTTCAACAACAGTGTTCGACTACTGCTTTAAACTTTGTTTGGTAATT GTATTCAGTATCATCCTATACTTCCTTGCTCACCTGCAATACAAGGCTGCAAGATTTTTC ATTTTCCTCCTGTTCCTTTCCTTTTACAATTTCTGTATGGTGTCCTTATTCGCTTTGACG ACACTAGTTGCTCCAACCATTTCAGTTGCAAATTTATTTGCAGGTATTCTGCTACTAGCT ATAGCAATGTATGCTTCTTACGTCATCTACCTGAAAAATATGCATCCTTGGTTTGTATGG ATTGCTTATCTAAATCCTGCAATGTACGCTATGGAGGCAATACTGTCTAATGAGCTTTAC AATTTGAAGCTGGATTGTAGTGAGACAATTGTTCCAAGAGGTCCTACTTACAACGATGTT CCATTTTCCCATAAGGCCTGTGCTTGGCAAGGTGCTACTCTGGGTAATGATTACGTTAGA GGCCGTGATTACTTGAAGCAAGGTTTATCCTACACGTATCATCATGTGTGGAGAAACTTT GGTATTATCATTGGTTTCCTAGTATTCTTTATTGCCTGTACTCTGTTTGCATCTCAATAT ATTAAGCCTTATTTCAATAAGGATGAAATAGAGCGCAACAATAGTCGTTTGACAAGATGG CTACCATTTTTGAATAAAAAGAGAGGTACCAGGTCCTCTGCAAGAAATGACAGTAAGTAT GTTGGTATCCCAAAGTCGCACTCCGTTTCGTCTTCCTCGTCTAGCCTGTCGGCTGTTCCA TATCAGATATCACCCTCAAATAAGGAAATGGCTCTAAACGATTATAACGAGCAACCTATC ACGGAAACAGTAGAGACTCAAAAGCATATCATCTCTTGGAAAAATATCAACTACACAGTT GGTACAAAGAAACTGATTAATAATGCATCCGGTTTCATCAGTTCTGGTTTGACCGCCTTA ATGGGTGAGTCCGGTGCAGGTAAAACTACTTTGCTGAATGTCTTATCACAAAGAGTTGAG ACAGGTGTTGTTAGCGGCGAAATTTTGATCGATGGCCACCCATTGACAGATGAGGACGCG TTTAAGAGAAGTATTGGTTTTGTTCAACAACAGGATTTGCATCTAGATTTGCTGTCTGTG AAAGAATCTCTGGAAATATCATGTCTTTTGAGAGGTGATGGTGACAGGGCATACTTAGAC ACTGTTTCAAATTTACTGAAATTGCCATCTGACATTTTAGTCGCTGATTTAAACCCGACT CAAAGGAAGCTTTTATCTATCGGTGTTGAACTTGTTACTAAGCCTTCACTTTTATTATTC CTAGACGAACCAACCTCTGGGCTGGACGCTGAGGCTGCACTAACAATCGTCAAATTTTTA AAACAACTTTCTTTACAGGGTCAGGCTATTTTTTGTACCATTCATCAGCCTAGTAAAAGT GTCATCAGCCATTTTGACAATATTTTCTTATTGAAAAGGGGTGGTGAATGTGTCTTCTTT GGACCAATGGACGATGCCTGCGGCTATTTCATGTCTCATGACAACACGCTCGTTTACGAT AAAGAACATGATAACCCTGCAGATTTCGTCATTGATGCAGTAGGTAACAGTAACTCCTCG GCAGGGAAAGATACAGCGGAGGAAGCTCTTACTTTGAACAAAGAAGCCATAGATTGGAGT GCATTATGGGAATCTTCTGTAGAAAAGAAACTAGTTAAAAAAGAAACAGCTAGGTTAGAA GATGATGCTCGTGCGTCTGGTGTTGATTACACAACCTCATTGTGGAAGCAGCCTTCCTAC TTACAGCAATTAGCTCTTATTACAAGAAGACAATATATTTGTACGAAAAGAGACATGACT TATGTCATGGCCAAGTACTGTTTGAATGGTGGCGCTGGTTTGTTTATCGGTTTCTCATTT TGGCACATTAAGCATAATATTATCGGTTTGCAGGATAGTATCTTCTTCTGTTTCATGGCT CTTTGTGTTTCATCTCCATTGATCAATCAAATTCAGGACAAAGCCTTGAAAACAAAGGAA GTTTATGTTGCTAGGGAGGCGAGATCTAACACTTATCACTGGACTGTTCTTCTTTTGTCA CAGTCAATTATTGAACTACCACTGGCACTTACAAGTTCCACACTATTTTTCGTCTGTGCC TTTTTCTCTTGTGGATTTAACAACGCTGGCTGGAGTGCCGGTGTTTTCTTTTTAAACTAT ATGCTTTTCGCTGCTTATTACTCGACTCTTGGTTTATGGCTGATCTATACTGCTCCTAAT CTACAAACTGCTGCTGTTTTTGTTGCGTTTATTTACAGTTTTACAGCATCATTCTGTGGT GTTATGCAACCATACTCTTTGTTTCCAACTTTTTGGAAATTCATGTACAGGGTTTCGCCA TACACATATTTTGTGGAAACTTTTGTTAGTATTCTATTGCATAACTGGGAAATCAAGTGT GACATGTCGGAGATGGTTCCTGGTCAACCTCTGACGGGGCAATCTTGTGGCCAATTTATG GAAGCTTTCATAGAAGAATACGGTGGCTATCTACATAATAAGAACACTTTCACAGTCTGC GCTTATTGTACGTACACTGTTGGCGATGACTTCCTGAAAAATGAGAATATGAGTTACGAC CACGTTTGGAGGAACTTTGGTATTGAATGGGCTTTTGTTGGTTTCAATTTCTTTGCGATG TTTGCTGGTTACTACTTAACTTACGTGGCAAGAATATGGCCAAAGGTCTTTAAAATTATC ACCAAAGTAATTCCACACAGAGGGAAGAAGCCTGTACAGAACTAA
Protein Properties
Pfam Domain Function
Protein Residues1394
Protein Molecular Weight157750.0
Protein Theoretical pI7.2
Signalling Regions
  • None
Transmembrane Regions
  • 421-443
  • 468-490
  • 497-519
  • 529-551
  • 558-575
  • 636-658
  • 1081-1103
  • 1107-1129
  • 1156-1178
  • 1193-1215
  • 1224-1246
  • 1346-1368
Protein Sequence>ATP-dependent permease AUS1 MSISKYFTPVADGSLTFNGANIQFGADAQGESKKSYDAEDSMPNPANQLNDITFQAEAGE MVLVLGYPTSTLFKTLFHGKTSLSYSPPGSIKFKNNEFKSFSEKCPHQIIYNNEQDVHFP FLTVEQTIDFALSCKFDIPKGERDQIRNELLREFGLSHVLKTIVGNDFFRGVSGGERKRI SIIETFIANGSVYLWDNSTKGLDSATALDFLEILRKMAKATRSVNLVRISQASDKIVDKF DKILMLSDSYQLFYGTVDECLTYFRDTLGIEKDPNDCIIEYLTSILNFQFKNKNLGNLSN SSSASVLKTATGEVTKYTYNSDFDLYDQWKHSSYYRNIKQQIQGSSIDDSIKEVDPSDVS PIFNIPLKKQLLFCTKRAFQRSLGDKAYMTAQFISVVIQSLVIGSLFYEIPLTTIGSYSR GSLTFFSILFFTFLSLADMPIAFQRQPVVKKQSQLHFYTNWVETLSTTVFDYCFKLCLVI VFSIILYFLAHLQYKAARFFIFLLFLSFYNFCMVSLFALTTLVAPTISVANLFAGILLLA IAMYASYVIYLKNMHPWFVWIAYLNPAMYAMEAILSNELYNLKLDCSETIVPRGPTYNDV PFSHKACAWQGATLGNDYVRGRDYLKQGLSYTYHHVWRNFGIIIGFLVFFIACTLFASQY IKPYFNKDEIERNNSRLTRWLPFLNKKRGTRSSARNDSKYVGIPKSHSVSSSSSSLSAVP YQISPSNKEMALNDYNEQPITETVETQKHIISWKNINYTVGTKKLINNASGFISSGLTAL MGESGAGKTTLLNVLSQRVETGVVSGEILIDGHPLTDEDAFKRSIGFVQQQDLHLDLLSV KESLEISCLLRGDGDRAYLDTVSNLLKLPSDILVADLNPTQRKLLSIGVELVTKPSLLLF LDEPTSGLDAEAALTIVKFLKQLSLQGQAIFCTIHQPSKSVISHFDNIFLLKRGGECVFF GPMDDACGYFMSHDNTLVYDKEHDNPADFVIDAVGNSNSSAGKDTAEEALTLNKEAIDWS ALWESSVEKKLVKKETARLEDDARASGVDYTTSLWKQPSYLQQLALITRRQYICTKRDMT YVMAKYCLNGGAGLFIGFSFWHIKHNIIGLQDSIFFCFMALCVSSPLINQIQDKALKTKE VYVAREARSNTYHWTVLLLSQSIIELPLALTSSTLFFVCAFFSCGFNNAGWSAGVFFLNY MLFAAYYSTLGLWLIYTAPNLQTAAVFVAFIYSFTASFCGVMQPYSLFPTFWKFMYRVSP YTYFVETFVSILLHNWEIKCDMSEMVPGQPLTGQSCGQFMEAFIEEYGGYLHNKNTFTVC AYCTYTVGDDFLKNENMSYDHVWRNFGIEWAFVGFNFFAMFAGYYLTYVARIWPKVFKII TKVIPHRGKKPVQN
References
External Links
ResourceLink
Saccharomyces Genome Database AUS1
Uniprot IDQ08409
Uniprot NameAUS1_YEAST
GenBank Gene IDZ74919
Genebank Protein ID1420108
General Reference
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Wilcox, L. J., Balderes, D. A., Wharton, B., Tinkelenberg, A. H., Rao, G., Sturley, S. L. (2002). "Transcriptional profiling identifies two members of the ATP-binding cassette transporter superfamily required for sterol uptake in yeast." J Biol Chem 277:32466-32472.12077145