You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInositol-1,4,5-trisphosphate 5-phosphatase 4
SynonymsNot Available
Gene NameINP54
Enzyme Class
Biological Properties
General FunctionInvolved in inositol or phosphatidylinositol phosphatase activity
Specific FunctionRegulates the phosphatidylinositol (4,5)-diphosphate levels on the cytoplasmic surface of the endoplasmic reticulum and thereby regulates secretion
Cellular LocationEndoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side
SMPDB Pathways
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB ReactionsNot Available
KEGG Reactions
water + 1D-myo-inositol 4,5-bisphosphatephosphate + 1-phosphatidyl-1D-myo-inositol 4-phosphate + hydron
Metabolites
YMDB IDNameView
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
inositol or phosphatidylinositol phosphatase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 15
LocusYOL065C
Gene Sequence>1155 bp ATGAACAAAACGAATTGGAAGGTATCTGTAACTACATTCAATTGTGGTAAGGAATTTCCC GTTGAAAATTCGAAAGCAATCGTTAAGCAATTGCTTTTCCCCTACGATGACGGCATCTCC CAATTGGAATTGCAAGATCTATATGTGTTGGGGTTCCAAGAAGTAGTCCCCATATGGCAA GGCTCCTTCCCTGCTGTTAATCGTGATTTAATCGATAGAATTACAACTACTGCGGTTAAT TGTCTGAATGAAAAAGTGTCAGCTACACAAGGGGATGAGCAGTATTCATGTTTAGGGGTG AATAGTCTTGGGGCGATTACCATAATAGTATTATACAATAATAATGCGCTAAAGGTAAAA GATGATATTTTGAAACGGAATGGGAAATGCGGTTGGTTTGGTACACACTTGAAAGGTGGA ACTTTGATAAGTTTTCAGATGACACGCAATGGCGAGGAGAACTGGGAAAGATTTAGCTAT ATTTGTGCTCATTTAAATGCAAATGAAGGTGTCAACAATAGAAATCAAAGAATAGATGAT TACAAACGAATAATGAGTGAAGTGTGTGATTCTGAGGTTGCAAAAAGCGACCACTTTTTC TTTCTAGGCGATTTGAATTTTAGGGTTACTAGTACTTATGATCCAACTACCAATTATTCG TCCACCACAACGTTAAGGCGTCTATTAGAAAATCATGAAGAACTAAATCTGCTACGTAAA GGAGAGGATGAACCGTTATGCAAAGGTTTTCAGGAGCTGAAGATAACATTTCCACCGACA TACAAATTCAAGTTGTTTGAAAAGGAAACATATAATACAAAAAGAATCCCGTCGTGGTGC GATAGGATTCTCTACAAAAGCTATGCAGTGCCAACTTTCGCACAAGAAGGTACTTACCAT TCCGTCCCTAGGTCCAATGCTCTATTATTTAGCGATCATCAACCCGTTAATCTTACCGTA AGATTACCAAGGTCTACAGGGACGCCAGTGCCGTTATCCTTACATATCGAAAAGTATCCT TTATCATGGAGCTCTGGCCTGATTGGACAAATTGGTGACGCAGTCATCGGGTACTGCGGT TGGCTAGTTACTAAGAATGTACATTATTGGATATTAGGTTCTTTACTATTATATTTACTA TTAAAAATCCTGTAA
Protein Properties
Pfam Domain Function
Protein Residues384
Protein Molecular Weight43798.69922
Protein Theoretical pI7.71
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inositol-1,4,5-trisphosphate 5-phosphatase 4 MNKTNWKVSVTTFNCGKEFPVENSKAIVKQLLFPYDDGISQLELQDLYVLGFQEVVPIWQ GSFPAVNRDLIDRITTTAVNCLNEKVSATQGDEQYSCLGVNSLGAITIIVLYNNNALKVK DDILKRNGKCGWFGTHLKGGTLISFQMTRNGEENWERFSYICAHLNANEGVNNRNQRIDD YKRIMSEVCDSEVAKSDHFFFLGDLNFRVTSTYDPTTNYSSTTTLRRLLENHEELNLLRK GEDEPLCKGFQELKITFPPTYKFKLFEKETYNTKRIPSWCDRILYKSYAVPTFAQEGTYH SVPRSNALLFSDHQPVNLTVRLPRSTGTPVPLSLHIEKYPLSWSSGLIGQIGDAVIGYCG WLVTKNVHYWILGSLLLYLLLKIL
References
External Links
ResourceLink
Saccharomyces Genome Database INP54
Uniprot IDQ08227
Uniprot NameINP54_YEAST
GenBank Gene IDZ74807
Genebank Protein ID1419885
General Reference
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Raucher, D., Stauffer, T., Chen, W., Shen, K., Guo, S., York, J. D., Sheetz, M. P., Meyer, T. (2000). "Phosphatidylinositol 4,5-bisphosphate functions as a second messenger that regulates cytoskeleton-plasma membrane adhesion." Cell 100:221-228.10660045
  • Wiradjaja, F., Ooms, L. M., Whisstock, J. C., McColl, B., Helfenbaum, L., Sambrook, J. F., Gething, M. J., Mitchell, C. A. (2001). "The yeast inositol polyphosphate 5-phosphatase Inp54p localizes to the endoplasmic reticulum via a C-terminal hydrophobic anchoring tail: regulation of secretion from the endoplasmic reticulum." J Biol Chem 276:7643-7653.11116155
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956