You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI20
Synonyms
  • Hydroxymethylpyrimidine kinase
  • HMP kinase
  • Hydroxymethylpyrimidine phosphate kinase
  • HMP-P kinase
  • HMP-phosphate kinase
  • HMPP kinase
Gene NameTHI20
Enzyme Class
Biological Properties
General FunctionInvolved in phosphomethylpyrimidine kinase activity
Specific FunctionCatalyzes the phosphorylation of hydroxymethylpyrimidine phosphate (HMP-P) to HMP-PP, and also probaby that of HMP to HMP- P
Cellular LocationNot Available
SMPDB Pathways
Vitamin B1/Thiamine metabolismPW002486 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Thiamine metabolismec00730 Map00730
SMPDB Reactions
Adenosine triphosphate + 4-amino-5-hydroxymethyl-2-methylpyrimidine4-amino-2-methyl-5-phosphomethylpyrimidine + ADP
Adenosine triphosphate + 4-amino-2-methyl-5-phosphomethylpyrimidineADP + 4-amino-2-methyl-5-diphosphomethylpyrimidine
4-amino-5-hydroxymethyl-2-methylpyrimidine + Adenosine triphosphate ADP + hydron + 4-amino-2-methyl-5-phosphomethylpyrimidine
pyrithiamine + water + oxidized electron acceptor → 4-amino-5-hydroxymethyl-2-methylpyrimidine + 2-(2-methylpyridin-3-yl)ethanol + reduced electron acceptor
oxythiamine + water5-(2-Hydroxyethyl)-4-methylthiazole + hydron + 5-(hydroxymethyl)-2-methyl-4(1H)-pyrimidinone
KEGG Reactions
Adenosine triphosphate + 4-amino-5-hydroxymethyl-2-methylpyrimidine4-amino-2-methyl-5-phosphomethylpyrimidine + hydron + ADP
4-amino-2-methyl-5-phosphomethylpyrimidine + Adenosine triphosphate4-amino-2-methyl-5-diphosphomethylpyrimidine + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB001174-amino-2-methyl-5-diphosphomethylpyrimidineShow
YMDB001184-amino-5-hydroxymethyl-2-methylpyrimidineShow
YMDB001284-amino-2-methyl-5-phosphomethylpyrimidineShow
YMDB00220ThiamineShow
YMDB007065-(2-Hydroxyethyl)-4-methylthiazoleShow
YMDB00793ToxopyrimidineShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00914ADPShow
YMDB16323pyrithiamineShow
YMDB163242-(2-methylpyridin-3-yl)ethanolShow
YMDB163265-(hydroxymethyl)-2-methyl-4(1H)-pyrimidinoneShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
phosphomethylpyrimidine kinase activity
Process
thiamin biosynthetic process
metabolic process
cellular metabolic process
cellular aromatic compound metabolic process
thiamin and derivative metabolic process
thiamin metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOL055C
Gene Sequence>1656 bp ATGACCTATTCTACAGTTAGCATCAACACGCCTCCACCATATCTTACTTTAGCCTGCAAC GAAAAGTTGCCAACAGTTTTATCCATTGCTGGAACAGATCCAAGTGGTGGAGCCGGTATC GAAGCTGATGTCAAAACTATCACAGCACACAGATGTTATGCCATGACATGTATCACTGCT TTAAATGCTCAAACTCCAGTTAAAGTCTACAGCATAAATAACACACCAAAAGAAGTGGTT TTCCAAACTTTGGAATCCAATTTAAAGGATATGAAATGTAATGTTATCAAAACCGGTATG CTTACCGCAGCTGCTATCGAAGTCTTGCACGAAAAACTGCTGCAACTCGGCGAAAATAGA CCTAAGTTGGTTGTTGATCCAGTTCTTGTCGCTACTTCTGGTTCTTCTTTAGCTGGAAAG GATATAGTTAGTTTGATTACGGAGAAGGTTGCACCTTTTGCTGATATTTTGACTCCTAAC ATCCCAGAGTGTTACAAATTGTTAGGTGAGGAAAGAAAGGTTAACGGATTACAGGATATT TTCCAAATCGCAAAAGACCTTGCTAAAATAACCAAGTGTTCGAATATACTAGTGAAGGGT GGCCATATTCCATGGAATGATGAAAAGGAAAAGTACATTACCGACGTTCTTTTCTTGGGT GCTGAACAAAAATTCATTATCTTTAAAGGCAATTTCGTTAACACCACGCATACACATGGT ACTGGGTGCACACTAGCTTCTGCCATTGCATCAAACTTGGCTCGTGGTTATTCTCTTCCT CAGTCTGTTTATGGTGGTATTGAATACGTCCAAAATGCCGTGGCAATTGGTTGTGATGTC ACAAAAGAAACTGTCAAGGATAATGGACCAATTAATCATGTTTACGCCGTGGAAATTCCA TTGGAGAAAATGCTCAGTGATGAATGTTTTACTGCATCAGATGTTATACCTAAAAAGCCG CTCAAAGGTGCTGCTGACAAAATCCCAGGCGGTAATTTCTATGAATACCTGATCAATCAC CCTAAAGTTAAGCCACACTGGGATTCCTATATTAACCATGAGTTTGTTAAAAAGGTTGCG GACGGTACATTAGAACGTAAGAAGTTTCAGTTCTTTATTGAACAAGATTATGCATACTTG GTTGATTATGCTAGAGTTCATTGTATCGCGGGTAGTAAAGCTCCATGCCTAGAAGATATG GAAAAGGAGCTAGTCATTGTTGGAGGTGTTCGTACTGAAATGGGTCAACATGAAAAGAGA TTAAAAGAAGTATTTGGTGTTAAAGATCCTGATTACTTTCAAAAGATTAAGAGAGGACCT GCATTAAGAGCTTACTCTCGTTACTTTAACGATGTTTCCAGAAGAGGTAACTGGCAAGAA TTGGTTGCATCCCTTACTCCTTGTTTGATGGGTTATGGTGAAGCTTTAACTAAAATGAAG GGTAAAGTCACCGCACCTGAAGGGTCCGTTTACCACGAATGGTGTGAAACTTACGCATCT TCATGGTATCGTGAAGCCATGGATGAAGGTGAAAAACTTTTGAACCACATCTTAGAAACA TACCCTCCAGAGCAACTTGACACTTTAGTAACAATCTACGCTGAAGTTTGTGAATTAGAA ACAAATTTTTGGACCGCTGCGCTAGAATACGAGTAG
Protein Properties
Pfam Domain Function
Protein Residues551
Protein Molecular Weight61268.89844
Protein Theoretical pI6.08
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase THI20 MTYSTVSINTPPPYLTLACNEKLPTVLSIAGTDPSGGAGIEADVKTITAHRCYAMTCITA LNAQTPVKVYSINNTPKEVVFQTLESNLKDMKCNVIKTGMLTAAAIEVLHEKLLQLGENR PKLVVDPVLVATSGSSLAGKDIVSLITEKVAPFADILTPNIPECYKLLGEERKVNGLQDI FQIAKDLAKITKCSNILVKGGHIPWNDEKEKYITDVLFLGAEQKFIIFKGNFVNTTHTHG TGCTLASAIASNLARGYSLPQSVYGGIEYVQNAVAIGCDVTKETVKDNGPINHVYAVEIP LEKMLSDECFTASDVIPKKPLKSAADKIPGGNFYEYLINHPKVKPHWDSYINHEFVKKVA DGTLERKKFQFFIEQDYAYLVDYARVHCIAGSKAPCLEDMEKELVIVGGVRTEMGQHEKR LKEVFGVKDPDYFQKIKRGPALRAYSRYFNDVSRRGNWQELVASLTPCLMGYGEALTKMK GKVTAPEGSVYHEWCETYASSWYREAMDEGEKLLNHILETYPPEQLDTLVTIYAEVCELE TNFWTAALEYE
References
External Links
ResourceLink
Saccharomyces Genome Database THI20
Uniprot IDQ08224
Uniprot NameTHI20_YEAST
GenBank Gene IDAY692780
Genebank Protein ID51013011
General Reference
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Mannhaupt, G., Vetter, I., Schwarzlose, C., Mitzel, S., Feldmann, H. (1996). "Analysis of a 26 kb region on the left arm of yeast chromosome XV." Yeast 12:67-76.8789261
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Llorente, B., Fairhead, C., Dujon, B. (1999). "Genetic redundancy and gene fusion in the genome of the Baker's yeast Saccharomyces cerevisiae: functional characterization of a three-member gene family involved in the thiamine biosynthetic pathway." Mol Microbiol 32:1140-1152.10383756
  • Haas, A. L., Laun, N. P., Begley, T. P. (2005). "Thi20, a remarkable enzyme from Saccharomyces cerevisiae with dual thiamin biosynthetic and degradation activities." Bioorg Chem 33:338-344.15967475