You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameD-xylulose reductase
Synonyms
  • Xylitol dehydrogenase
  • XDH
Gene NameXYL2
Enzyme Class
Biological Properties
General FunctionInvolved in zinc ion binding
Specific FunctionXylitol + NAD(+) = D-xylulose + NADH
Cellular LocationNot Available
SMPDB Pathways
xylitol degradationPW002433 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose and glucuronate interconversionsec00040 Map00040
SMPDB Reactions
D-Xylitol + NADNADH + hydron + D-Xylulose
KEGG Reactions
NAD + XylitolNADH + D-Xylulose + hydron
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00161D-XyluloseShow
YMDB00373D-XylitolShow
YMDB00412NAD(+)Show
YMDB00778XylitolShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
oxidoreductase activity
zinc ion binding
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR070C
Gene Sequence>1071 bp ATGACTGACTTAACTACACAAGAAGCTATTGTTCTAGAGCGACCTGGTAAAATCACCCTA ACTAATGTCAGCATCCCAAAGATTTCAGATCCTAACGAAGTAATCATCCAGATCAAGGCG ACAGGAATATGCGGGTCAGATATCCATTACTATACCCATGGAAGAATAGCCAATTACGTG GTAGAATCACCAATGGTGCTGGGACATGAATCATCAGGAATAGTGGCCCTCATAGGTGAG AACGTCAAGACACTTAAAGTAGGAGATAGGGTGGCACTTGAGCCCGGAATACCTGACAGG TTTTCACCGGAGATGAAAGAGGGCAGATACAACCTGGACCCCAATTTAAAATTTGCTGCG ACACCTCCCTTTGATGGGACCTTGACAAAGTATTATAAGACCATGAAAGATTTCGTCTAT AAACTTCCTGATGATGTGTCATTCGAGGAAGGAGCACTAATAGAGCCATTATCAGTGGCA ATCCATGCTAATAAATTAGCAAAGATCAAGTTTGGAGCCCGTTGCGTCGTCTTTGGAGCT GGGCCCATAGGTTTGCTAGCCGGGAAAGTAGCCAGTGTCTTTGGTGCTGCAGATGTTGTT TTTGTAGATCTATTAGAAAACAAGCTGGAAACGGCTAGGCAGTTTGGTGCCACCCACATC GTCAACTCAGGTGATCTCCCACATGGCGTTACTGTAGATAGTGTTATAAAAAAAGCAATC GGCAAGAAAGGTGCTGACGTTGTGTTTGAATGTTCTGGTGCAGAGCCTTGCGTTCGAGCA GGCATCGAAGTCTGTAAGGCAGGTGGAACGATCGTTCAAGTTGGAATGGGACAAGAGGAA ATACAATTTCCCATCTCGATCATTCCAACAAAAGAACTGACATTCCAAGGCTGTTTCCGA TACTGTCAAGGTGATTATAGTGACTCCATCGAGCTAGTCTCTAGCAGAAAACTCTCGCTT AAACCATTCATTACACATCGCTATAGCTTTAAGGATGCTGTCGAGGCATTCGAAGAAACA AGCCACCACCCGTTAAATAATATCAAGACGATCATTGAGGGCCCGGAATGA
Protein Properties
Pfam Domain Function
Protein Residues356
Protein Molecular Weight38600.10156
Protein Theoretical pI6.06
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>D-xylulose reductase MTDLTTQEAIVLERPGKITLTNVSIPKISDPNEVIIQIKATGICGSDIHYYTHGRIANYV VESPMVLGHESSGIVALIGENVKTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFAA TPPFDGTLTKYYKTMKDFVYKLPDDVSFEEGALIEPLSVAIHANKLAKIKFGARCVVFGA GPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVNSGDLPHGVTVDSVIKKAI GKKGADVVFECSGAEPCVRAGIEVCKAGGTIVQVGMGQEEIQFPISIIPTKELTFQGCFR YCQGDYSDSIELVSSRKLSLKPFITHRYSFKDAVEAFEETSHHPLNNIKTIIEGPE
References
External Links
ResourceLink
Saccharomyces Genome Database XYL2
Uniprot IDQ07993
Uniprot NameXYL2_YEAST
GenBank Gene IDZ73242
Genebank Protein ID1360424
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Richard, P., Toivari, M. H., Penttila, M. (1999). "Evidence that the gene YLR070c of Saccharomyces cerevisiae encodes a xylitol dehydrogenase." FEBS Lett 457:135-138.10486580