You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSterol esterase 2
Synonyms
  • Steryl ester hydrolase 2
Gene NameYEH2
Enzyme Class
Biological Properties
General FunctionInvolved in lipid metabolic process
Specific FunctionMediates the hydrolysis of steryl esters. Required for mobilization of steryl ester, thereby playing a central role in lipid metabolism
Cellular LocationCell membrane; Single-pass type II membrane protein
SMPDB Pathways
Steroid biosynthesisPW002482 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
Cholesterol + Palmitic acidCE(18:0) + water
KEGG Reactions
ergosterol + fatty acid ↔ ergosterol ester + water
24-methylidene-5alpha-cholest-8-en-3beta-ol + fatty acid ↔ fecosterol ester + water
zymosterol + fatty acid ↔ zymosterol ester + water
Metabolites
YMDB IDNameView
YMDB00069Palmitic acidShow
YMDB00313CholesterolShow
YMDB00543ergosterolShow
YMDB0054524-methylidene-5alpha-cholest-8-en-3beta-olShow
YMDB00548zymosterolShow
YMDB00890waterShow
YMDB16199CE(18:0)Show
GO Classification
Component
Not Available
Function
Not Available
Process
metabolic process
primary metabolic process
lipid metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR020C
Gene Sequence>1617 bp ATGGTAAATAAGGTGGTTGATGAGGTTCAGCGGTTGGTGAGCGCAATAATTCTCACTTCG TTTATGACGGGGTTATTCATTTTGTCACTATGGAAGAATTACGTGACAGTTCATTTCCAA CATAAAAATGATCCAAGAGATACAAGAAGTTCGAGAACCAAGATCCAGCCAAATGACAAG AAGAAGAAACGACCAGCACGTCACTCTAGACCTTTGTCAATATCTTCCACAACGCCCTTA GATTTACAGCGGGATCAGGAAAATAATATTGAATATGACCGTACTGTGACTAGCAAGCTG TCCATGACTAGTAATGCCTCTTTATCAGAGAACGGTGATGGAAATGCTAATATTAAAATG GAAACGAATGTGAACCAAGCCCCATATGCTGCAGAGAATCCCTTCCAAAACATTGCGCTT GCGGAGGATACCAAGCTGGTACCTGACTTAAAGTACTATTATAAAGAGTATGGTATTGAT ATTGAAGAATTTGAGGTGGAGACAGACGACGGTTTTATCATTGATTTGTGGCACTTCAAG TCCAGGTTAAACGATGGCGTAGAGGAAGTGAAACGTGAACCCATTTTGCTATTACACGGT CTTTTGCAAAGTTGCGGGGCCTTCGCATCTTCAGGTAGAAAATCTCTGGCATACTTCCTT TATGAATCTGGATTTGATGTTTGGTTGGGGAATAACAGATGTGGCTTAAATGCCAAGTGG AACATGAAAAAATTAGGTAATGATCATTCCAAAAAATGGGATTGGGATATGCACCAGATG GTTCAATACGATTTAAAAGCACTTATAAATTATGTACTTGATAGTACCGGATATGCTAAA CTATCGCTCGTGGCGCATTCACAAGGTACAACACAAGGGTTTATGGGGCTTGTCAACGGT GAGAAACTATACGCAAGTGATTTTAAATTAGTCGATAAGCTGGAAAACTTTGTTGCTTTG GCACCTGCAGTGTACCCTGGACCTTTATTGGATGAAAAAGCATTTGTGAGGCTAATGGCA AAAGGTATTGATTCTCCGTGGTACTTTGGTAGAAGATCGTTTATACCTCTTATGATGACA ATGAGAAAACTAATGGTTGGGACCAAGATTTTTTCGTTCCTCTCATACATCATGTTTAAC TACCTATTTGATTGGAACGATGTCTTATGGGATAGAGTTTTAAGGGACCGAAATTTCTTA TTTTCACCAGTCCATATTTCCGTCAAACTAATGCAATGGTGGTTGTCACCTCTTCCTAAT AAGCTAAGTTTTAAGAAGGGTGCAGAGAAAATTTTTCCAGATAAAAAGACATGGTTTCCT ATTGCCAAGAATGATGATGACAGTGGCAATAATTTGGATAACAACAAACTACACTTAAAT CCGAAAAGACAAAATAGTGAAGAATTTCCACACATTATAATGTTTATTCCAAAGCAAGAT AGATTAGTAGATGGTGAACGATTAATTAATCACTTCATTAATCATGAAGCAAATGCAGTG TACAAAATCTGGTATATTGATGAGTATTCCCATCTGGACGTTTTATGGGCGCATGATGTT ATAGATAGAATTGGTAAGCCAATGATAGAAAATTTGAGGTTTCCTAATGCAAGGTGA
Protein Properties
Pfam Domain Function
Protein Residues538
Protein Molecular Weight62446.0
Protein Theoretical pI8.74
Signalling Regions
  • None
Transmembrane Regions
  • 12-32
Protein Sequence>Sterol esterase 2 MVNKVVDEVQRLVSAIILTSFMTGLFILSLWKNYVTVHFQHKNDPRDTRSSRTKIQPNDK KKKRPARHSRPLSISSTTPLDLQRDQENNIEYDRTVTSKLSMTSNASLSENGDGNANIKM ETNVNQAPYAAENPFQNIALAEDTKLVPDLKYYYKEYGIDIEEFEVETDDGFIIDLWHFK SRLNDGVEEVKREPILLLHGLLQSCGAFASSGRKSLAYFLYESGFDVWLGNNRCGLNAKW NMKKLGNDHSKKWDWDMHQMVQYDLKALINYVLDSTGYAKLSLVAHSQGTTQGFMGLVNG EKLYASDFKLVDKLENFVALAPAVYPGPLLDEKAFVRLMAKGIDSPWYFGRRSFIPLMMT MRKLMVGTKIFSFLSYIMFNYLFDWNDVLWDRVLRDRNFLFSPVHISVKLMQWWLSPLPN KLSFKKGAEKIFPDKKTWFPIAKNDDDSGNNLDNNKLHLNPKRQNSEEFPHIIMFIPKQD RLVDGERLINHFINHEANAVYKIWYIDEYSHLDVLWAHDVIDRIGKPMIENLRFPNAR
References
External Links
ResourceLink
Saccharomyces Genome Database YEH2
Uniprot IDQ07950
Uniprot NameYEH2_YEAST
GenBank Gene IDZ73192
Genebank Protein ID1360324
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Mullner, H., Deutsch, G., Leitner, E., Ingolic, E., Daum, G. (2005). "YEH2/YLR020c encodes a novel steryl ester hydrolase of the yeast Saccharomyces cerevisiae." J Biol Chem 280:13321-13328.15632184
  • Koffel, R., Tiwari, R., Falquet, L., Schneiter, R. (2005). "The Saccharomyces cerevisiae YLL012/YEH1, YLR020/YEH2, and TGL1 genes encode a novel family of membrane-anchored lipases that are required for steryl ester hydrolysis." Mol Cell Biol 25:1655-1668.15713625
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956