You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMulticopy enhancer of UAS2
SynonymsNot Available
Gene NameMEU1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionSeems to be implicated in the regulation of the expression of the ADH2 gene
Cellular LocationNot Available
SMPDB Pathways
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
phosphate + 5'-S-methyl-5'-thioadenosine5-Methylthioribose 1-phosphate + Adenine
KEGG Reactions
phosphate + 5'-MethylthioadenosineS-Methyl-5-thio-alpha-D-ribose 1-phosphate + Adenine
Metabolites
YMDB IDNameView
YMDB000405-Methylthioribose 1-phosphateShow
YMDB001785'-MethylthioadenosineShow
YMDB00887AdenineShow
YMDB00907phosphateShow
YMDB00961S-Methyl-5-thio-alpha-D-ribose 1-phosphateShow
YMDB162765'-S-methyl-5'-thioadenosineShow
GO Classification
Component
Not Available
Function
transferase activity, transferring pentosyl groups
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
Process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside metabolic process
metabolic process
nitrogen compound metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR017W
Gene Sequence>1014 bp ATGAACAGGATTAAGAATACATTTTCTGTTGCTAAGAGATTAAAACTAAGCAAAGTTATG ACGAACTCAGAATTACCGAGCATATTCGAAGGAACTGTTGATTTAGGGATTATTGGTGGT ACAGGTTTATATAACCTTGACTGTCTGGAGCCCATCGCTTTGGTTCCACCCATGGTAACA CCATGGGGTACCACATCGTCTCCTGTCACAATCTCTCAGTTCGTAGGAACTAACAGCCAC TTTCACGTTGCGTTCATAGCCAGACACGGTATTAACCACGAATACCCACCCACTAAAGTC CCATTTAGAGCAAACATGGCGGCCTTAAAGAACTTAAATTGTAAAGCCGTTCTTTCTTTT AGTGCCGTGGGGTCTTTACAACCCCATATAAAGCCTAGAGATTTTGTGTTACCACAGCAA ATAATCGACAGAACTAAAGGCATAAGACATTCTTCATATTTCAACGATGAAGGCTTGGTA GGTCACGTTGGTTTCGGACAGCCGTTCTCTCAAAAATTCGCAGAGTATATCTATCAATTC AAGAACGAGATAACAAATCCTGAATCCGAAGAACCGTGCCATTTGCATTACGACAAGGAT ATGACCGTTGTGTGTATGGAAGGCCCACAATTCTCCACGCGCGCTGAATCCAAGATGTAC AGAATGTTTGGTGGCCATGTTATTAACATGAGTGTTATTCCAGAAGCCAAATTGGCGCGT GAGTGTGAGCTGCCTTACCAGATGATTTGTATGTCTACCGATTACGACGCATGGAGAGAT GAGGCAGAACCTGTTACCGTAGAAACCGTTATTGGTAATTTGACGAATAATGGGCGCAAT GCAAATATTTTAGCTTCTAAGATCATCGTCTCAATGGCCAAGGAAATCCCAGAGTTCATG CATACTGGCGATGGGCTGCGCGGTTCCATCAAGAAATCTATCTCTACCAAACCAGAGGCT ATGTCCAAGGAAACCTTAGAAAGACTAAGATACTTATTTCCAAACTATTGGTAA
Protein Properties
Pfam Domain Function
Protein Residues337
Protein Molecular Weight37856.30078
Protein Theoretical pI7.89
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Multicopy enhancer of UAS2 MNRIKNTFSVAKRLKLSKVMTNSELPSIFEGTVDLGIIGGTGLYNLDCLEPIALLPPMVT PWGTTSSPVTISQFVGTNSHFHVAFIARHGINHEYPPTKVPFRANMAALKNLNCKAVLSF SAVGSLQPHIKPRDFVLPQQIIDRTKGIRHSSYFNDEGLVGHVGFGQPFSQKFAEYIYQF KNEITNPESEEPCHLHYDKDMTVVCMEGPQFSTRAESKMYRMFGGHVINMSVIPEAKLAR ECELPYQMICMSTDYDAWRDEAEPVTVETVIGNLTNNGRNANILASKIIVSMAKEIPEFM HTGDGLRGSIKKSISTKPEAMSKETLERLRYLFPNYW
References
External Links
ResourceLink
Saccharomyces Genome Database MEU1
Uniprot IDQ07938
Uniprot NameMEU1_YEAST
GenBank Gene IDX90564
Genebank Protein ID975224
General Reference
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Donoviel, M. S., Young, E. T. (1996). "Isolation and identification of genes activating UAS2-dependent ADH2 expression in Saccharomyces cerevisiae." Genetics 143:1137-1148.8807288
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Subhi, A. L., Diegelman, P., Porter, C. W., Tang, B., Lu, Z. J., Markham, G. D., Kruger, W. D. (2003). "Methylthioadenosine phosphorylase regulates ornithine decarboxylase by production of downstream metabolites." J Biol Chem 278:49868-49873.14506228