You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePolyamine transporter 1
SynonymsNot Available
Gene NameTPO1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transport
Specific FunctionCell membrane polyamine/proton antiporter, involved in the detoxification of excess polyamines in the cytoplasm. Catalyzes polyamine uptake at alkaline pH and excretion at acidic pH. Recognizes spermidine, spermine and putrescine, the polyamine analogs methylglyoxal bis(guanylhydrazone) (MGBG) and paraquat, the antimalarial drug quinidine, and cycloheximide. Confers resistance to the non-steroidal anti-inflammatory drug indomethacin
Cellular LocationCell membrane; Multi-pass membrane protein.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00132PutrescineShow
YMDB00231SpermineShow
YMDB00232SpermidineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
drug transmembrane transporter activity
transporter activity
transmembrane transporter activity
Process
establishment of localization
transport
drug transport
transmembrane transport
Gene Properties
Chromosome Locationchromosome 12
LocusYLL028W
Gene Sequence>1761 bp ATGTCGGATCATTCTCCCATTTCTAATAAGGAAAATCATCTGCTGCCATCAGACTCGTCA AGAAGCTCATCCAGCGATATGCATTCGACGGGCACCACGGGAACCACAGGCGTCGAACCT GTAGATTTCACCGGTGAAGGTGCCAAATACACAACTGCTACGGAGGGCAATGGTGGTGCA GATTTAGCGATTCAAAGAACGACGACTATGAATTCTGCTGCAGAATCAGAGGTTAATATC ACGAGAAGATTAACTAAAATCCTTACTGGGTCTGTTAACGAGCCTGACCGTGTAGAGGTT GATTATACCAATTGTGCGCCCATGGGTGGTGACAGACCTTACCCTCCATCGTTGCCGAGC AGAGACCTGTACGAGGTTACTTTTGATGGTCCTAACGACCCACTACATCCATTTAACTGG CCCATGAAGAAGAAAGTGCTGCTATGTCTGGTCTTATGTCTGGATTCTATTGCCATTGCT ATGTGTTCTTCCATTTTTGCCTCTGCAGTGCCGCAAATCTGCGAGATATACCACGTCATC GAAGTTGTCGCCATTTTGGGTATCACGCTTTTTGTTCTTGGGTTTGCGGCCTCACCGGTT ATCTATGCTCCTCTTTCTGAATTGTACGGTAGAAAGGGTGTTCTGGTTTTATCTGCGTTT GGATTTGCCCTTTTCCAATTTGCTGTCGCTACTGCTGAGAACCTGCAAACTATTTTCATA TGTAGATTCTTTGGTGGTTTTATCGGGGCAGCACCCATGGCCGTCGTCCCCGCCGCGTTT GCCGACATGTTTGATACTAATGTTAGAGGTAAAGCCATTGCGCTATTTTCTCTAGGTGTT TTTGTAGGCCCCATTTTATCGCCTGTCATGGGTTCTTATATCGCACAAAGAACTACCTGG AGATGGTTAGAATATGTTGTCGGTTGTTTCGCTTCCGCAGTTTTCGTTGCCATCGTATTG TTCTTTGAAGAAACACATCACCCTACCATTTTGGTTAACAAGGCCAAACAGATGAGAAAG CAAAGTAATAACTGGGGTATTCATGCTGCTCATGAAGACGTGGAGCTATCCATCAAAGAC ATTGTCCAAAAAACTGTGACGAGGCCTATCATTATGCTTTTCGTGGAACCATTGCTACTA TTCGTGACTATTTACAACTCTTTTGTCTACGGTATCTTGTATTTGTTACTGGAAGCCTAC CCACTTGTCTTTGTGGAGGGTTATGGGTTTACTGAAAACGGTGAGTTGCCATACATCGCC TTGATTATCGGTATGATGGTGTGTGCTGCTTTCATTTGGTATATGGACAACGATTATTTG AAAAGATGTAGAGCCAAGGGGAAATTAGTGCCCGAGGCCAGATTGTACGCAATGGTCATT GCAGGTACCGTTTTCCCTATTGGTATCTTATGGTTCTGTTGGACGGGCTACTATCCTCAC AAGATTCATTGGATGGTCCCCACAGTAGGAGGGGCCTTCATCGGGTTCGGTTTAATGGGT ATTTTCTTGCCATGTTTAAACTATATCATTGAATCGTATCTATTGTTGGCAGCTTCTGCC GTCGCAGCAAACACTTTCATGAGGTCTGCATTTGGTGCATGCTTCCCATTGTTTGCAGGA TATATGTTCCGTGGCATGGGTATCGGTTGGGCTGGTTTGTTATTAGGTCTATTTGCCGCT GCGATGATTCCCGTGCCTTTACTATTCTTAAAATATGGTGAATCTATCAGAAAGAAATCC AAGTATGCTTACGCCGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues586
Protein Molecular Weight64271.60156
Protein Theoretical pI6.88
Signalling Regions
  • None
Transmembrane Regions
  • 146-166
  • 182-202
  • 213-233
  • 243-263
  • 272-292
  • 302-322
  • 377-397
  • 415-435
  • 455-475
  • 484-504
  • 506-526
  • 529-549
  • 550-570
Protein Sequence>Polyamine transporter 1 MSDHSPISNKENHLLPSDSSRSSSSDMHSTGTTGTTGVEPVDFTGEGAKYTTATEGNGGA DLAIQRTTTMNSAAESEVNITRRLTKILTGSVNEPDRVEVDYTNCAPMGGDRPYPPSLPS RDLYEVTFDGPNDPLHPFNWPMKKKVLLCLVLCLDSIAIAMCSSIFASAVPQICEIYHVI EVVAILGITLFVLGFAASPVIYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFI CRFFGGFIGAAPMAVVPAAFADMFDTNVRGKAIALFSLGVFVGPILSPVMGSYIAQRTTW RWLEYVVGCFASAVFVAIVLFFEETHHPTILVNKAKQMRKQSNNWGIHAAHEDVELSIKD IVQKTVTRPIIMLFVEPLLLFVTIYNSFVYGILYLLLEAYPLVFVEGYGFTENGELPYIA LIIGMMVCAAFIWYMDNDYLKRCRAKGKLVPEARLYAMVIAGTVFPIGILWFCWTGYYPH KIHWMVPTVGGAFIGFGLMGIFLPCLNYIIESYLLLAASAVAANTFMRSAFGACFPLFAG YMFRGMGIGWAGLLLGLFAAAMIPVPLLFLKYGESIRKKSKYAYAA
References
External Links
ResourceLink
Saccharomyces Genome Database TPO1
Uniprot IDQ07824
Uniprot NameTPO1_YEAST
GenBank Gene IDZ73133
Genebank Protein ID1360210
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Tomitori, H., Kashiwagi, K., Sakata, K., Kakinuma, Y., Igarashi, K. (1999). "Identification of a gene for a polyamine transport protein in yeast." J Biol Chem 274:3265-3267.9920864
  • Tomitori, H., Kashiwagi, K., Asakawa, T., Kakinuma, Y., Michael, A. J., Igarashi, K. (2001). "Multiple polyamine transport systems on the vacuolar membrane in yeast." Biochem J 353:681-688.11171066
  • do Valle Matta, M. A., Jonniaux, J. L., Balzi, E., Goffeau, A., van den Hazel, B. (2001). "Novel target genes of the yeast regulator Pdr1p: a contribution of the TPO1 gene in resistance to quinidine and other drugs." Gene 272:111-119.11470516
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Kim, H., Melen, K., von Heijne, G. (2003). "Topology models for 37 Saccharomyces cerevisiae membrane proteins based on C-terminal reporter fusions and predictions." J Biol Chem 278:10208-10213.12524434
  • Albertsen, M., Bellahn, I., Kramer, R., Waffenschmidt, S. (2003). "Localization and function of the yeast multidrug transporter Tpo1p." J Biol Chem 278:12820-12825.12562762
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Shepard, K. A., Gerber, A. P., Jambhekar, A., Takizawa, P. A., Brown, P. O., Herschlag, D., DeRisi, J. L., Vale, R. D. (2003). "Widespread cytoplasmic mRNA transport in yeast: identification of 22 bud-localized transcripts using DNA microarray analysis." Proc Natl Acad Sci U S A 100:11429-11434.13679573
  • Aranda, A., del Olmo, M. L. (2004). "Exposure of Saccharomyces cerevisiae to acetaldehyde induces sulfur amino acid metabolism and polyamine transporter genes, which depend on Met4p and Haa1p transcription factors, respectively." Appl Environ Microbiol 70:1913-1922.15066780
  • Uemura, T., Tachihara, K., Tomitori, H., Kashiwagi, K., Igarashi, K. (2005). "Characteristics of the polyamine transporter TPO1 and regulation of its activity and cellular localization by phosphorylation." J Biol Chem 280:9646-9652.15637075
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Mima, S., Ushijima, H., Hwang, H. J., Tsutsumi, S., Makise, M., Yamaguchi, Y., Tsuchiya, T., Mizushima, H., Mizushima, T. (2007). "Identification of the TPO1 gene in yeast, and its human orthologue TETRAN, which cause resistance to NSAIDs." FEBS Lett 581:1457-1463.17362938
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956