You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable guanine deaminase
Synonyms
  • Guanase
  • Guanine aminase
  • Guanine aminohydrolase
  • GAH
Gene NameGUD1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionCatalyzes the hydrolytic deamination of guanine, producing xanthine and ammonia
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
water + hydron + GuanineXanthine + Ammonium
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00263XanthineShow
YMDB00423AmmoniumShow
YMDB00698GuanineShow
YMDB006999H-xanthineShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
zinc ion binding
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
catalytic activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
guanine deaminase activity
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDL238C
Gene Sequence>1470 bp ATGACAAAAAGTGATTTATTATTTGATAAATTCAACGACAAACATGGAAAGTTTCTAGTT TTTTTTGGTACCTTTGTAGATACCCCTAAATTAGGAGAGCTGAGAATCAGAGAGAAAACA TCTGTTGGAGTTCTCAACGGAATCATCAGGTTTGTGAACAGAAATTCACTCGATCCTGTC AAAGATTGTTTAGATCACGATAGTAGCTTATCACCAGAGGATGTCACGGTGGTTGACATA ATTGGAAAAGACAAGACTCGAAATAACAGCTTTTATTTTCCAGGTTTTGTTGACACGCAT AACCATGTCTCGCAATATCCAAATGTCGGCGTATTTGGGAATTCTACCCTGCTGGATTGG CTAGAGAAGTATACCTTCCCCATAGAAGCCGCACTAGCAAACGAAAATATTGCGAGAGAA GTTTACAATAAGGTAATAAGTAAGACGCTTTCTCACGGTACAACGACTGTGGCTTACTAT AATACCATTGATCTCAAGTCCACTAAGCTCTTGGCTCAACTAAGCTCCTTATTGGGGCAG CGTGTTCTTGTTGGAAAAGTGTGCATGGATACCAATGGTCCCGAGTATTATATTGAAGAT ACTAAAACTTCCTTTGAAAGCACTGTGAAAGTTGTTAAGTACATACGGGAAACCATTTGT GATCCCCTCGTAAATCCTATAGTGACACCAAGGTTCGCGCCCTCTTGTTCTAGAGAACTA ATGCAACAGTTGTCCAAGCTAGTCAAGGATGAAAACATACACGTTCAAACCCACTTGTCG GAAAATAAGGAGGAGATACAGTGGGTTCAAGATTTATTTCCCGAATGTGAGAGCTATACT GATGTATACGACAAATATGGGCTGCTCACAGAAAAAACAGTATTGGCACATTGTATTCAT CTAACAGATGCCGAAGCGCGTGTGATTAAACAGCGTCGCTGTGGTATATCTCATTGTCCC ATTTCCAACTCCTCTCTGACTTCTGGAGAGTGTAGGGTTCGATGGTTGCTGGACCAGGGC ATAAAGGTTGGTCTAGGCACCGACGTTTCAGCCGGTCATTCTTGTAGCATACTCACCACC GGAAGGCAGGCCTTTGCAGTTTCAAGGCATTTGGCAATGAGAGAAACTGATCATGCAAAA CTTTCAGTCTCCGAGTGCCTATTTCTTGCTACAATGGGCGGAGCACAAGTCTTGCGTATG GATGAGACCTTGGGGACTTTTGACGTCGGTAAGCAGTTTGACGCTCAAATGATCGATACC AATGCTCCCGGCTCAAACGTGGATATGTTTCATTGGCAGCTAAAGGAGAAGGATCAAATG CAAGAGCAAGAGCAAGAGCAAGGGCAAGACCCTTATAAGAACCCACCGCTGCTTACTAAT GAAGACATAATCGCAAAATGGTTCTTTAACGGTGATGATCGCAACACCACTAAAGTTTGG GTAGCCGGCCAGCAAGTCTACCAGATTTAG
Protein Properties
Pfam Domain Function
Protein Residues489
Protein Molecular Weight55203.19922
Protein Theoretical pI5.9
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable guanine deaminase MTKSDLLFDKFNDKHGKFLVFFGTFVDTPKLGELRIREKTSVGVLNGIIRFVNRNSLDPV KDCLDHDSSLSPEDVTVVDIIGKDKTRNNSFYFPGFVDTHNHVSQYPNVGVFGNSTLLDW LEKYTFPIEAALANENIAREVYNKVISKTLSHGTTTVAYYNTIDLKSTKLLAQLSSLLGQ RVLVGKVCMDTNGPEYYIEDTKTSFESTVKVVKYIRETICDPLVNPIVTPRFAPSCSREL MQQLSKLVKDENIHVQTHLSENKEEIQWVQDLFPECESYTDVYDKYGLLTEKTVLAHCIH LTDAEARVIKQRRCGISHCPISNSSLTSGECRVRWLLDQGIKVGLGTDVSAGHSCSILTT GRQAFAVSRHLAMRETDHAKLSVSECLFLATMGGAQVLRMDETLGTFDVGKQFDAQMIDT NAPGSNVDMFHWQLKEKDQMQEQEQEQGQDPYKNPPLLTNEDIIAKWFFNGDDRNTTKVW VAGQQVYQI
References
External Links
ResourceLink
Saccharomyces Genome Database GUD1
Uniprot IDQ07729
Uniprot NameGUAD_YEAST
GenBank Gene IDZ74286
Genebank Protein ID1431404
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106