Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycyl-tRNA synthetase 2
Synonyms
  • Diadenosine tetraphosphate synthetase
  • AP-4-A synthetase
  • Glycine--tRNA ligase 2
  • GlyRS 2
  • GlyRS2
Gene NameGRS2
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionCatalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + Glycine + tRNA(Gly) → Adenosine monophosphate + Pyrophosphate + Gly-tRNA(Gly)
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
binding
nucleoside binding
purine nucleoside binding
glycine-tRNA ligase activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
catalytic activity
nucleotide binding
ligase activity
Process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
glycyl-tRNA aminoacylation
metabolic process
cellular macromolecule metabolic process
macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
biosynthetic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR081C
Gene Sequence>1857 bp ATGCCGTTAATGTCCAATTCGGAAAGAGATAAATTGGAAAGTACATTGAGGAGAAGGTTT TTCTACACACCCTCGTTTGAGATATATGGTGGTGTGTCAGGTTTATTTGATTTAGGGCCT CCGGGTTGTCAGTTGCAAAATAACTTGATTCGACTGTGGCGAGAACATTTTATTATGGAA GAAAACATGCTTCAGGTTGATGGGCCAATGCTAACTCCTTACGATGTGTTGAAGACTTCT GGGCATGTAGACAAATTTACTGATTGGATGTGCCGAAATCCTAAGACTGGGGAATACTAC AGAGCAGACCATTTGATTGAACAGACGTTGAAAAAACGGCTGTTGGACAAGGATGTCAAT CCACAGGATATGAAAAATATGGAGAAAATATTGACCACGATTGACGGGTTTTCGGGTCCT GAGTTGAATCTCGTCATGCAGGAATATAACATTAATGATCCAGTCACTAACGATGTTTTA GACGCACTAACTTCCTTTAATTTGATGTTCGAAACTAAAATTGGAGCCTCAGGACAATTG AAGGCCTTTCTAAGGCCAGAGACTGCACAAGGACAATTTCTCAATTTCAACAAATTATTG GAAATCAACCAAGGGAAAATTCCGTTTGCTTCAGCTTCCATTGGTAAGTCATTCAGAAAC GAAATTTCCCCCAGAAGTGGGCTTTTAAGGGTAAGAGAGTTTTTAATGGCAGAAATTGAG CACTTTGTTGATCCGTTGAATAAGTCACATGCAAAATTCAATGAAGTGTTAAATGAGGAG ATTCCACTACTATCACGCAGATTACAGGAAAGTGGTGAAGTCCAACTGCCTGTGAAAATG ACTATAGGAGAGGCAGTGAATTCTGGAATGGTAGAAAATGAAACATTGGGATATTTTATG GCAAGAGTTCATCAATTTTTGTTGAATATTGGGATCAACAAGGACAAATTCAGATTTCGC CAGCATTTGAAGAATGAAATGGCACACTATGCCACAGATTGTTGGGACGGTGAAATTTTA ACATCGTATGGTTGGATTGAATGTGTCGGTTGTGCTGACAGGGCGGCTTTTGATTTAACT GTACACTCCAAGAAAACGGGAAGAAGTCTGACGGTAAAGCAAAAGCTAGATACACCAAAA GAAAGAACCGAGTGGGTTGTGGAAGTGAATAAGAAATTTTTCGGATCGAAGTTCAAACAG AAAGCAAAATTAATCGAATCTGTTTTGTCAAAATTTTCCCAGGATGAATTGATTAGGAGG CATGAAGAACTGGAAAAGAACGGTGAATTTACCTGTCAAGTAAATGGCCAGATCGTAAAA CTAGATAGCAGTTTGGTTACTATCAAAATGAAGACAACTTTGCAACATATACGAGAGTAC ATTCCTAATGTCATTGAGCCCTCGTTCGGTTTAGGTCGTATCATATACTGCATCTTCGAC CATTGTTTCCAAGTTCGAGTGGATAGTGAGTCAAGAGGCTTCTTCTCTTTTCCATTACAG ATAGCGCCGATCAAAGTATTTGTTACGACAATATCGAATAACGATGGCTTCCCCGCTATA CTTAAGAGGATCTCGCAGGCTTTACGTAAAAGAGAGATATACTTTAAAATTGACGATTCC AATACTTCAATTGGTAAAAAATACGCCCGTAACGATGAATTGGGAACACCATTTGGTATC ACCATAGATTTCGAAACTATAAAAGACCAAACGGTGACGTTAAGAGAAAGAAATTCTATG AGGCAAGTAAGAGGCACTATTACTGATGTGATTTCGACCATTGACAAAATGCTTCACAAC CCTGATGAATCGGACTGGGATAAATCAACATTTGGACTGTCGCCTGTTAAGATATAA
Protein Properties
Pfam Domain Function
Protein Residues618
Protein Molecular Weight71017.89844
Protein Theoretical pI7.58
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycyl-tRNA synthetase 2 MPLMSNSERDKLESTLRRRFFYTPSFEIYGGVSGLFDLGPPGCQLQNNLIRLWREHFIME ENMLQVDGPMLTPYDVLKTSGHVDKFTDWMCRNPKTGEYYRADHLIEQTLKKRLLDKDVN PQDMKNMEKILTTIDGFSGPELNLVMQEYNINDPVTNDVLDALTSFNLMFETKIGASGQL KAFLRPETAQGQFLNFNKLLEINQGKIPFASASIGKSFRNEISPRSGLLRVREFLMAEIE HFVDPLNKSHAKFNEVLNEEIPLLSRRLQESGEVQLPVKMTIGEAVNSGMVENETLGYFM ARVHQFLLNIGINKDKFRFRQHLKNEMAHYATDCWDGEILTSYGWIECVGCADRAAFDLT VHSKKTGRSLTVKQKLDTPKERTEWVVEVNKKFFGSKFKQKAKLIESVLSKFSQDELIRR HEELEKNGEFTCQVNGQIVKLDSSLVTIKMKTTLQHIREYIPNVIEPSFGLGRIIYCIFD HCFQVRVDSESRGFFSFPLQIAPIKVFVTTISNNDGFPAILKRISQALRKREIYFKIDDS NTSIGKKYARNDELGTPFGITIDFETIKDQTVTLRERNSMRQVRGTITDVISTIDKMLHN PDESDWDKSTFGLSPVKI
References
External Links
ResourceLink
Saccharomyces Genome Database GRS2
Uniprot IDQ06817
Uniprot NameSYG2_YEAST
GenBank Gene IDU51033
Genebank Protein ID1230687
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Turner, R. J., Lovato, M., Schimmel, P. (2000). "One of two genes encoding glycyl-tRNA synthetase in Saccharomyces cerevisiae provides mitochondrial and cytoplasmic functions." J Biol Chem 275:27681-27688.10874035
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106