You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycyl-tRNA synthetase 2
Synonyms
  • Diadenosine tetraphosphate synthetase
  • AP-4-A synthetase
  • Glycine--tRNA ligase 2
  • GlyRS 2
  • GlyRS2
Gene NameGRS2
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionCatalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + Glycine + tRNA(Gly) → Adenosine monophosphate + Pyrophosphate + Gly-tRNA(Gly)
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
GO Classification
Component
cytoplasm
cell part
intracellular part
Function
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
glycine-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
catalytic activity
nucleotide binding
ligase activity
binding
Process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
glycyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
Gene Properties
Chromosome Locationchromosome 16
LocusYPR081C
Gene Sequence>1857 bp ATGCCGTTAATGTCCAATTCGGAAAGAGATAAATTGGAAAGTACATTGAGGAGAAGGTTT TTCTACACACCCTCGTTTGAGATATATGGTGGTGTGTCAGGTTTATTTGATTTAGGGCCT CCGGGTTGTCAGTTGCAAAATAACTTGATTCGACTGTGGCGAGAACATTTTATTATGGAA GAAAACATGCTTCAGGTTGATGGGCCAATGCTAACTCCTTACGATGTGTTGAAGACTTCT GGGCATGTAGACAAATTTACTGATTGGATGTGCCGAAATCCTAAGACTGGGGAATACTAC AGAGCAGACCATTTGATTGAACAGACGTTGAAAAAACGGCTGTTGGACAAGGATGTCAAT CCACAGGATATGAAAAATATGGAGAAAATATTGACCACGATTGACGGGTTTTCGGGTCCT GAGTTGAATCTCGTCATGCAGGAATATAACATTAATGATCCAGTCACTAACGATGTTTTA GACGCACTAACTTCCTTTAATTTGATGTTCGAAACTAAAATTGGAGCCTCAGGACAATTG AAGGCCTTTCTAAGGCCAGAGACTGCACAAGGACAATTTCTCAATTTCAACAAATTATTG GAAATCAACCAAGGGAAAATTCCGTTTGCTTCAGCTTCCATTGGTAAGTCATTCAGAAAC GAAATTTCCCCCAGAAGTGGGCTTTTAAGGGTAAGAGAGTTTTTAATGGCAGAAATTGAG CACTTTGTTGATCCGTTGAATAAGTCACATGCAAAATTCAATGAAGTGTTAAATGAGGAG ATTCCACTACTATCACGCAGATTACAGGAAAGTGGTGAAGTCCAACTGCCTGTGAAAATG ACTATAGGAGAGGCAGTGAATTCTGGAATGGTAGAAAATGAAACATTGGGATATTTTATG GCAAGAGTTCATCAATTTTTGTTGAATATTGGGATCAACAAGGACAAATTCAGATTTCGC CAGCATTTGAAGAATGAAATGGCACACTATGCCACAGATTGTTGGGACGGTGAAATTTTA ACATCGTATGGTTGGATTGAATGTGTCGGTTGTGCTGACAGGGCGGCTTTTGATTTAACT GTACACTCCAAGAAAACGGGAAGAAGTCTGACGGTAAAGCAAAAGCTAGATACACCAAAA GAAAGAACCGAGTGGGTTGTGGAAGTGAATAAGAAATTTTTCGGATCGAAGTTCAAACAG AAAGCAAAATTAATCGAATCTGTTTTGTCAAAATTTTCCCAGGATGAATTGATTAGGAGG CATGAAGAACTGGAAAAGAACGGTGAATTTACCTGTCAAGTAAATGGCCAGATCGTAAAA CTAGATAGCAGTTTGGTTACTATCAAAATGAAGACAACTTTGCAACATATACGAGAGTAC ATTCCTAATGTCATTGAGCCCTCGTTCGGTTTAGGTCGTATCATATACTGCATCTTCGAC CATTGTTTCCAAGTTCGAGTGGATAGTGAGTCAAGAGGCTTCTTCTCTTTTCCATTACAG ATAGCGCCGATCAAAGTATTTGTTACGACAATATCGAATAACGATGGCTTCCCCGCTATA CTTAAGAGGATCTCGCAGGCTTTACGTAAAAGAGAGATATACTTTAAAATTGACGATTCC AATACTTCAATTGGTAAAAAATACGCCCGTAACGATGAATTGGGAACACCATTTGGTATC ACCATAGATTTCGAAACTATAAAAGACCAAACGGTGACGTTAAGAGAAAGAAATTCTATG AGGCAAGTAAGAGGCACTATTACTGATGTGATTTCGACCATTGACAAAATGCTTCACAAC CCTGATGAATCGGACTGGGATAAATCAACATTTGGACTGTCGCCTGTTAAGATATAA
Protein Properties
Pfam Domain Function
Protein Residues618
Protein Molecular Weight71017.89844
Protein Theoretical pI7.58
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycyl-tRNA synthetase 2 MPLMSNSERDKLESTLRRRFFYTPSFEIYGGVSGLFDLGPPGCQLQNNLIRLWREHFIME ENMLQVDGPMLTPYDVLKTSGHVDKFTDWMCRNPKTGEYYRADHLIEQTLKKRLLDKDVN PQDMKNMEKILTTIDGFSGPELNLVMQEYNINDPVTNDVLDALTSFNLMFETKIGASGQL KAFLRPETAQGQFLNFNKLLEINQGKIPFASASIGKSFRNEISPRSGLLRVREFLMAEIE HFVDPLNKSHAKFNEVLNEEIPLLSRRLQESGEVQLPVKMTIGEAVNSGMVENETLGYFM ARVHQFLLNIGINKDKFRFRQHLKNEMAHYATDCWDGEILTSYGWIECVGCADRAAFDLT VHSKKTGRSLTVKQKLDTPKERTEWVVEVNKKFFGSKFKQKAKLIESVLSKFSQDELIRR HEELEKNGEFTCQVNGQIVKLDSSLVTIKMKTTLQHIREYIPNVIEPSFGLGRIIYCIFD HCFQVRVDSESRGFFSFPLQIAPIKVFVTTISNNDGFPAILKRISQALRKREIYFKIDDS NTSIGKKYARNDELGTPFGITIDFETIKDQTVTLRERNSMRQVRGTITDVISTIDKMLHN PDESDWDKSTFGLSPVKI
References
External Links
ResourceLink
Saccharomyces Genome Database GRS2
Uniprot IDQ06817
Uniprot NameSYG2_YEAST
GenBank Gene IDU51033
Genebank Protein ID1230687
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Turner, R. J., Lovato, M., Schimmel, P. (2000). "One of two genes encoding glycyl-tRNA synthetase in Saccharomyces cerevisiae provides mitochondrial and cytoplasmic functions." J Biol Chem 275:27681-27688.10874035
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106