You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase
Synonyms
  • InsP6 and PP-IP5 kinase
Gene NameVIP1
Enzyme Class
Biological Properties
General FunctionInvolved in acid phosphatase activity
Specific FunctionBifunctional inositol kinase that catalyzes the formation of diphosphoinositol pentakisphosphate (InsP7 or PP- InsP5) and bi-diphosphoinositol tetrakisphosphate (InsP8 or PP2- InsP4). Converts inositolitol hexakisphosphate (InsP6) to InsP7. Also able to convert InsP7 to InsP8. Probably specifically mediates the formation of 4PP-InsP5 and 6PP-InsP5 InsP7 isomers but not of 5PP-IP5 InsP7 isomer. Required for maintaining celllular integrity, normal growth and interactions with the ARP complex. Acts as a regulator of the PHO80-PHO85 cyclin/cyclin-dependent kinase (CDK) complex, thereby regulating signaling of phosphate availability. Required for the function of the cortical actin cytoskeleton, possibly by participating in correct F-actin localization and ensuring polarized growth
Cellular LocationCytoplasm. Cytoplasm, cytoskeleton
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
water + 4-Diphospho-1D-myo-inositol pentakisphosphateMyo-Inositol hexakisphosphate + phosphate + hydron
5-Diphosphoinositol pentakisphosphate + phosphate + hydron4,5-Bis(diphospho)-1D-myo-inositol tetrakisphosphate + water
5-Diphosphoinositol pentakisphosphate + phosphate + hydronwater + 5,6-Bis(diphospho)-1D-myo-inositol tetrakisphosphate
water + 6-Diphospho-1D-myo-inositol pentakisphosphateMyo-Inositol hexakisphosphate + phosphate + hydron
Metabolites
YMDB IDNameView
YMDB000135-Diphosphoinositol pentakisphosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00500Myo-Inositol hexakisphosphateShow
YMDB005014-Diphospho-1D-myo-inositol pentakisphosphateShow
YMDB005024,5-Bis(diphospho)-1D-myo-inositol tetrakisphosphateShow
YMDB005215,6-Bis(diphospho)-1D-myo-inositol tetrakisphosphateShow
YMDB005236-Diphospho-1D-myo-inositol pentakisphosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00914ADPShow
YMDB00946Inositol 1,3,4,5,6-pentakisphosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
acid phosphatase activity
catalytic activity
hydrolase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 12
LocusYLR410W
Gene Sequence>3441 bp ATGAGTGGGATAAAGAAGGAACCGATTGAATCTGATGAGGTTCCTCAACAAGAGACAAAA AATAACTTACCTAGTGCACCTTCTGAGATGTCACCCCTTTTCCTAAACAAAAACACACAG AAGGCTATGCAATCTATTGCACCAATATTGGAGGGTTTCAGTCCTAAGACGTCAGCTAGC GAAAATATGTCTTTGAAATTGCCACCTCCCGGTATTCAAGATGATCACAGTGAAGAGAAT CTCACCGTGCATGATACTCTGCAAAGAACCATAAGCACTGCACTAGGAAACGGAAACAAC ACCAATACAGTTACAACTTCCGGTTTAAAAAAGGCAGACAGTGAATCAAAGTCAGAAGCT GATCCTGAGGGGCTCAGCAATTCTAACATAGTCAATGATGCAGATAACATAAATTCCATC TCCAAGACCGGATCGCCCCATTTACCTCAAGGAACAATGGACGCTGAGCAGACTAACATG GGAACTAACTCTGTACCTACTTCATCAGCTTCTTCACGCAAATCCTCGACTAGTCATCCC AAACCTAGGCTACCCAAGGTAGGGAAGATTGGGGTATGTGCAATGGATGCAAAAGTCCTT TCAAAGCCAATGAGACACATTTTGAATCGTTTAATTGAACATGGTGAATTTGAAACTGTC ATTTTTGGAGATAAGGTGATTCTAGATGAAAGAATAGAGAATTGGCCAACTTGCGACTTT TTGATATCTTTCTTTTCTTCAGGATTTCCCCTAGATAAAGCAATTAAATACGTCAAGTTA CGCAAGCCTTTCATTATCAATGATTTAATAATGCAAAAGATTTTGTGGGACAGGAGATTA TGTCTACAAGTATTAGAAGCCTACAACGTTCCAACACCTCCTAGACTGGAAATCAGTAGA GATGGTGGTCCCCGTGCCAACGAAGAATTAAGGGCAAAATTACGTGAGCATGGCGTAGAA GTTAAACCCGTTGAAGAACCGGAATGGAAAATGGTTGATGATGATACTTTAGAAGTTGAT GGGAAAACCATGACTAAGCCCTTTGTTGAAAAGCCCGTTGATGGTGAAGACCACAACATT TATATATACTATCATTCTAAGAACGGAGGAGGCGGTCGTCGTCTATTCCGTAAAGTTGGT AACAAGTCTTCTGAGTTTGATCCTACTTTGGTTCATCCTCGTACGGAGGGGTCTTACATT TATGAGCAGTTTATGGATACCGATAATTTCGAAGATGTGAAGGCTTATACGATTGGTGAG AACTTTTGTCACGCTGAAACTAGGAAATCACCTGTGGTTGATGGTATAGTTAGAAGAAAT ACTCATGGTAAAGAAGTTAGATATATTACTGAGTTATCAGACGAAGAGAAAACCATTGCT GGGAAAGTTTCCAAAGCTTTTTCACAAATGATCTGTGGTTTCGATTTGCTTCGCGTTTCT GGTAAAAGTTACGTCATTGATGTTAACGGATTTTCTTTTGTAAAGGATAACAAAGCTTAC TATGATTCATGCGCCAATATATTGAGAAGTACCTTCATTGAAGCCAAAAAGAAGATGGAT ATGGAAAAGAAGAATCTGCCCATTATTCGTGAAGAAAAGGAACAAAAGTGGGTATTCAAA GGACTGGCTATCATTATCCGTCACGCGGACAGAACACCAAAACAGAAATTCAAACATTCA TTCACTTCGCCTATTTTTATATCGTTACTAAAAGGTCACAAAGAAGAAGTTGTCATTCGG AATGTAAATGATTTAAAGATTGTTCTTCAGGCCTTAAGAATTGCGTTAGATGAAAAAGCA GGAAATCCAGCTAAAATTAAAGTGTTAGCAAACGCTCTAGAAAAGAAACTGAATTTTCCC GGTACGAAAATACAATTGAAACCGGTTTTAAATAAAGAGAACGAAGTGGAAAAAGTTCAG TTTATTTTGAAATGGGGTGGTGAACCCACTCATTCTGCCAAATATCAGGCTACGGAACTC GGAGAGCAAATGAGACAAGATTTTGACCTATTGAATAAGAGCATTCTACAAAACATCAAG ATATTTTCATCGTCTGAGAGACGTGTTCTTCATACGGCGCAGTACTGGACCAGAGCTCTT TTTGGGGCCGATGAATTAGGTAGCGATGAAATCAGTATTAGAAAGGATCTTTTAGATGAC AGTAATGCCGCCAAAGATTTAATGGATAAGGTGAAAAAGAAGTTGAAGCCACTTTTAAGA GAGGGTAAGGAAGCTCCCCCACAATTTGCCTGGCCTTCAAAGATGCCGGAGCCATATTTA GTCATAAAGCGAGTGGTTGAATTGATGAATTACCATAAAAAAATTATGGATAACAACTTT GCTAAAAAGGATGTCAACTCGATGCAAACAAGATGGTGTACTTCTGAAGATCCTAGTTTG TTTAAGGAAAGGTGGGATAAACTTTTCAAAGAATTCAATAATGCTGAAAAAGTCGATCCT TCTAAAATTTCTGAATTGTATGATACTATGAAGTATGATGCTCTTCACAACAGGCAGTTC CTAGAGAACATATTTGACCCGGGTCTTCCAAATGAAGCTATCGCCGATGAACTCGGCAGT CATTCTTTAGTTGACCGATACCCAATTAACGTTCTCGCCAAAAATAATTTTAAGATAATA GACAGTCATAGCATGAACAATTCTGGAAAGAACAGTAGTAATAGTGTTGGGTCGTTAGGA TGGGTTCTGGAAAGCGGAAAAACATCTACAGCAAGAAACCCCAAATCTTCTTCTCAATTC GATGAGCCACGCTTTATGCAGTTGCGGGAGCTGTATAAGCTGGCCAAAGTATTGTTTGAT TTTATCTGCCCCAAAGAATATGGTATTTCAGATGCAGAGAAACTGGATATCGGTTTGTTA ACTTCGTTGCCTTTGGCAAAGCAAATACTAAATGATATAGGAGACATGAAAAATAGAGAA ACTCCAGCTTGTGTTGCGTACTTCACCAAAGAGTCCCATATTTACACTCTATTGAATATC ATATACGAATCTGGTATTCCAATGAGAATCGCTAGAAATGCTTTACCAGAACTAGACTAC TTGTCGCAGATCACTTTTGAACTTTATGAGAGTACGGATGCTTCTGGTCAAAAATCGCAT TCCATTAGACTAAAAATGTCTCCTGGGTGTCATACTCAAGATCCGTTAGATGTTCAATTA GATGACAGGCATTATATTAGTTGTATTCCAAAGATTTCCCTGACGAAGCATTTGGATATG GACTATGTTCAACAGAAATTGAGAAACAAATTTACCAGGGTCATTATGCCTCCGAAATTT ACACCAGTAAACATTACGAGCCCCAACTTGAGTTTCCAGAAACGCAAAACCAGAAGAAAG TCGGTATCTGTTGAGAAGTTGAAACGTCCTGCCTCGTCCGGATCTTCATCATCTACCTCC GTTAACAAGACATTAGATTAG
Protein Properties
Pfam Domain Function
Protein Residues1146
Protein Molecular Weight129754.0
Protein Theoretical pI9.01
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase MSGIKKEPIESDEVPQQETKNNLPSAPSEMSPLFLNKNTQKAMQSIAPILEGFSPKTSAS ENMSLKLPPPGIQDDHSEENLTVHDTLQRTISTALGNGNNTNTVTTSGLKKADSESKSEA DPEGLSNSNIVNDADNINSISKTGSPHLPQGTMDAEQTNMGTNSVPTSSASSRKSSTSHP KPRLPKVGKIGVCAMDAKVLSKPMRHILNRLIEHGEFETVIFGDKVILDERIENWPTCDF LISFFSSGFPLDKAIKYVKLRKPFIINDLIMQKILWDRRLCLQVLEAYNVPTPPRLEISR DGGPRANEELRAKLREHGVEVKPVEEPEWKMVDDDTLEVDGKTMTKPFVEKPVDGEDHNI YIYYHSKNGGGGRRLFRKVGNKSSEFDPTLVHPRTEGSYIYEQFMDTDNFEDVKAYTIGE NFCHAETRKSPVVDGIVRRNTHGKEVRYITELSDEEKTIAGKVSKAFSQMICGFDLLRVS GKSYVIDVNGFSFVKDNKAYYDSCANILRSTFIEAKKKMDMEKKNLPIIREEKEQKWVFK GLAIIIRHADRTPKQKFKHSFTSPIFISLLKGHKEEVVIRNVNDLKIVLQALRIALDEKA GNPAKIKVLANALEKKLNFPGTKIQLKPVLNKENEVEKVQFILKWGGEPTHSAKYQATEL GEQMRQDFDLLNKSILQNIKIFSSSERRVLHTAQYWTRALFGADELGSDEISIRKDLLDD SNAAKDLMDKVKKKLKPLLREGKEAPPQFAWPSKMPEPYLVIKRVVELMNYHKKIMDNNF AKKDVNSMQTRWCTSEDPSLFKERWDKLFKEFNNAEKVDPSKISELYDTMKYDALHNRQF LENIFDPGLPNEAIADELGSHSLVDRYPINVLAKNNFKIIDSHSMNNSGKNSSNSVGSLG WVLESGKTSTARNPKSSSQFDEPRFMQLRELYKLAKVLFDFICPKEYGISDAEKLDIGLL TSLPLAKQILNDIGDMKNRETPACVAYFTKESHIYTLLNIIYESGIPMRIARNALPELDY LSQITFELYESTDASGQKSHSIRLKMSPGCHTQDPLDVQLDDRHYISCIPKISLTKHLDM DYVQQKLRNKFTRVIMPPKFTPVNITSPNLSFQKRKTRRKSVSVEKLKRPASSGSSSSTS VNKTLD
References
External Links
ResourceLink
Saccharomyces Genome Database VIP1
Uniprot IDQ06685
Uniprot NameVIP1_YEAST
GenBank Gene IDU20162
Genebank Protein ID632676
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Feoktistova, A., McCollum, D., Ohi, R., Gould, K. L. (1999). "Identification and characterization of Schizosaccharomyces pombe asp1(+), a gene that interacts with mutations in the Arp2/3 complex and actin." Genetics 152:895-908.10388810
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Mulugu, S., Bai, W., Fridy, P. C., Bastidas, R. J., Otto, J. C., Dollins, D. E., Haystead, T. A., Ribeiro, A. A., York, J. D. (2007). "A conserved family of enzymes that phosphorylate inositol hexakisphosphate." Science 316:106-109.17412958
  • Lee, Y. S., Mulugu, S., York, J. D., O'Shea, E. K. (2007). "Regulation of a cyclin-CDK-CDK inhibitor complex by inositol pyrophosphates." Science 316:109-112.17412959
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956