You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInositol-pentakisphosphate 2-kinase
Synonyms
  • Inositol-1,3,4,5,6-pentakisphosphate 2-kinase
  • Ins(1,3,4,5,6)P5 2-kinase
  • InsP5 2-kinase
Gene NameIPK1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionHas kinase activity and phosphorylates inositol- 1,3,4,5,6-pentakisphosphate (Ins(1,3,4,5,6)P5) to produce 1,2,3,4,5,6-hexakisphosphate (InsP6), also known as phytate
Cellular LocationNucleus
SMPDB Pathways
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB Reactions
5-Diphosphoinositol pentakisphosphate + Adenosine triphosphateMyo-Inositol hexakisphosphate + ADP + hydron
KEGG Reactions
Adenosine triphosphate + hydron + Inositol 1,3,4,5,6-pentakisphosphateMyo-Inositol hexakisphosphate + ADP
Metabolites
YMDB IDNameView
YMDB000135-Diphosphoinositol pentakisphosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00500Myo-Inositol hexakisphosphateShow
YMDB00806Myo-Inositol hexakisphosphate(12-)Show
YMDB00862hydronShow
YMDB00914ADPShow
YMDB00946Inositol 1,3,4,5,6-pentakisphosphateShow
GO Classification
Component
Not Available
Function
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
kinase activity
inositol or phosphatidylinositol kinase activity
inositol pentakisphosphate 2-kinase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR315C
Gene Sequence>846 bp ATGCAAGTCATCGGACGTGGTGGGGCAAATATACTGATTGATTATGGGGATCCTACGTGG TTGTGGCGATGCTGCATCCGTTGGCCCGATCTGTTATCATCAAATAATTCTTATACAATC AAAAACATCAGTTATATTAAAGATTATGTAGAACCTCTTCTACATGGCTTGCTTTGCCCG ATGTATCTGATTGACGTCGATATAGAAGCTATAAGGCCAATTCTCAGTGACTTTATTCTA AATTTAGACGATAAGGTAGTCAAAGTTATCAAAATTAAAAATCTCACCAATAATACCTCA AATCTGATATTAAATAACCACTTTTTAAAATCTTATTGTTCACAAAATCTGCAAACAGTT ATTTTAGAATTGAAGCCTAAATGGTTATACTATGATACAGATTACTGTAGGAACTGTACT CATAATGCATTTAAGGGTAGAGGCACTAAGTACTGTTACAATCAATTACTAATGAATCCA GCACACTTGGAATTAATATTTGGAGAATGTAATATATTTCCGGTTAAGTTTAAAGATGCC ATGCATGAGTACTTGCGCAATGACAATAACATTTTCAAGATCCTTTATGATTTACAGAAA AAACTTACAAAGAACACAACTCCAATAAGTGACATAAAATCAATCAACGATGTAAACGAT GAGCATCTGCTACTCATGACACTCAGAGACGTGACATGTTTCATTGAATGGAACAGTGCT GAAAATGCGTTGCACGTGAATATAATAGATGTAGATCTAAAGCCGAAAGAAAAATGGACC CATTGGACAAAAACTTACAGCCAGTTGACATCAAGCCAAAAAATTTATCATACTTCAAAT AAATAA
Protein Properties
Pfam Domain Function
Protein Residues281
Protein Molecular Weight32917.69922
Protein Theoretical pI7.95
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inositol-pentakisphosphate 2-kinase MQVIGRGGANILIDYGDPTWLWRCCIRWPDLLSSNNSYTIKNISYIKDYVEPLLHGLLCP MYLIDVDIEAIRPILSDFILNLDDKVVKVIKIKNLTNNTSNLILNNHFLKSYCSQNLQTV ILELKPKWLYYDTDYCRNCTHNAFKGRGTKYCYNQLLMNPAHLELIFGECNIFPVKFKDA MHEYLRNDNNIFKILYDLQKKLTKNTTPISDIKSINDVNDEHLLLMTLRDVTCFIEWNSA ENALHVNIIDVDLKPKEKWTHWTKTYSQLTSSQKIYHTSNK
References
External Links
ResourceLink
Saccharomyces Genome Database IPK1
Uniprot IDQ06667
Uniprot NameIPK1_YEAST
GenBank Gene IDAY557740
Genebank Protein ID45269371
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • York, J. D., Odom, A. R., Murphy, R., Ives, E. B., Wente, S. R. (1999). "A phospholipase C-dependent inositol polyphosphate kinase pathway required for efficient messenger RNA export." Science 285:96-100.10390371
  • Ives, E. B., Nichols, J., Wente, S. R., York, J. D. (2000). "Biochemical and functional characterization of inositol 1,3,4,5, 6-pentakisphosphate 2-kinases." J Biol Chem 275:36575-36583.10960485