You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycogen debranching enzyme
Synonyms
  • Glycogen debrancher
  • 4-alpha-glucanotransferase
  • Oligo-1,4-1,4-glucantransferase
  • Amylo-alpha-1,6-glucosidase
  • Amylo-1,6-glucosidase
  • Dextrin 6-alpha-D-glucosidase
Gene NameGDB1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionMultifunctional enzyme acting as 1,4-alpha-D-glucan:1,4- alpha-D-glucan 4-alpha-D-glycosyltransferase and amylo-1,6- glucosidase in glycogen degradation
Cellular LocationMitochondrion. Cytoplasm
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB ReactionsNot Available
KEGG Reactions
Glycogen + waterD-Glucose
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00881GlycogenShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
glycogen debranching enzyme activity
amylo-alpha-1,6-glucosidase activity
catalytic activity
binding
ion binding
cation binding
4-alpha-glucanotransferase activity
Process
glycogen metabolic process
metabolic process
glycogen biosynthetic process
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR184W
Gene Sequence>4611 bp ATGAATAGATCATTACTGCTACGTTTGTCGGATACCGGTGAACCCATTACAAGCTGCTCT TACGGAAAAGGTGTCTTGACGCTACCACCAATTCCGCTCCCTAAGGACGCCCCAAAGGAC CAACCGCTCTATACGGTCAAGCTACTGGTATCTGCAGGTTCCCCTGTCGCTAGGGATGGG CTAGTTTGGACTAATTGCCCACCAGATCACAACACGCCCTTCAAGAGGGACAAATTTTAC AAAAAAATCATTCATTCCAGCTTTCACGAGGATGACTGCATTGACTTGAATGTCTACGCT CCAGGCTCGTACTGCTTTTATCTATCTTTCAGGAACGATAACGAAAAACTTGAGACAACA AGGAAATACTACTTTGTTGCCTTGCCTATGCTTTATATAAACGATCAGTTCCTACCTTTG AATTCCATCGCTTTACAAAGTGTTGTATCGAAATGGCTGGGCTCTGACTGGGAGCCAATC CTATCGAAAATTGCCGCTAAAAACTACAATATGGTACATTTCACCCCTCTACAGGAAAGA GGCGAGTCTAACTCGCCTTACTCTATATACGACCAATTGCAGTTCGACCAGGAACACTTC AAGTCTCCTGAAGACGTGAAAAATTTAGTTGAGCATATACATCGCGATTTAAACATGCTT TCATTAACAGATATTGTTTTTAACCACACAGCTAATAATTCTCCTTGGTTAGTTGAGCAC CCGGAGGCTGGGTATAACCACATCACTGCGCCACATCTAATCAGCGCCATAGAGCTCGAC CAAGAATTGCTCAATTTTAGTAGGAATTTGAAATCCTGGGGCTATCCTACCGAACTGAAA AATATAGAAGATCTCTTCAAGATCATGGACGGTATTAAAGTGCATGTCTTAGGGTCGTTG AAACTGTGGGAATATTATGCGGTAAACGTGCAAACAGCTCTTCGGGATATCAAGGCCCAT TGGAATGACGAATCTAACGAAAGTTACAGTTTTCCCGAGAATATTAAAGACATCTCGTCC GATTTCGTAAAACTAGCTTCCTTTGTGAAGGACAACGTCACTGAGCCAAACTTTGGCACT CTTGGTGAAAGAAACTCAAACAAGATTAACGTTCCAAAATTTATTCAACTACTGAAGCTC ATTAACGATGGTGGTAGTGATGACAGTGAATCTTCGTTGGCCACGGCTCAAAACATCTTG AACGAGGTCAACTTACCCTTATATAGAGAATACGACGATGACGTCAGTGAGATACTCGAG CAACTGTTCAATCGTATCAAATATTTGAGATTAGATGACGGTGGGCCCAAGCAAGGTCCA GTGACCGTCGACGTGCCCTTAACAGAGCCTTACTTTACGAGGTTCAAAGGAAAAGATGGT ACTGATTATGCCCTCGCCAACAATGGCTGGATATGGAATGGTAACCCACTAGTGGATTTT GCATCGCAGAATTCAAGAGCTTATTTACGTAGAGAAGTTATCGTGTGGGGGGACTGTGTC AAGTTAAGATACGGTAAAAGCCCTGAAGACTCTCCGTATCTGTGGGAAAGAATGTCCAAG TATATAGAAATGAACGCCAAGATATTTGACGGGTTCAGAATTGACTACTGCCATTCTACT CCAATACATGTTGGCGAATATTTCCTAGATTTGGCAAGAAAATACAACCCGAACCTATAT GTCGTTGCAGAGCTGTTTTCTGGTTCCGAAACACTAGATTGTCTGTTTGTTGAACGGTTG GGTATCTCCTCTTTAATCAGAGAAGCAATGCAAGCCTGGTCCGAAGAAGAGTTGTCTAGA TTAGTCCATAAGCATGGCGGGAGGCCCATTGGCTCCTATAAGTTTGTTCCTATGGATGAC TTCTCATATCCTGCGGATATTAATTTAAACGAGGAGCATTGTTTCAACGACTCCAACGAT AACTCCATAAGATGTGTATCAGAGATCATGATTCCAAAGATTTTAACCGCCACTCCGCCA CACGCTTTATTCATGGACTGTACCCATGATAATGAAACTCCCTTTGAAAAAAGAACAGTG GAGGATACTTTGCCCAATGCTGCATTGGTGGCTCTTTGCTCGTCCGCCATTGGATCTGTT TATGGCTACGACGAAATTTTTCCACATTTACTGAATTTGGTCACTGAAAAAAGACATTAC GACATTTCTACTCCTACTGGTAGCCCCTCGATAGGAATAACCAAAGTCAAGGCCACTTTG AATTCGATTAGAACGAGTATAGGAGAAAAGGCGTATGACATTGAAGACTCAGAAATGCAT GTGCATCACCAGGGCCAGTACATTACTTTTCATCGTATGAATGTTAAATCCGGAAAAGGT TGGTACTTGATAGCAAGGATGAAATTTTCTGACAATGATGACCCTAACGAGACTTTACCA CCAGTGGTGTTAAATCAATCCACCTGTTCTCTCAGGTTTTCGTATGCTTTGGAAAGAGTT GGCGATGAAATTCCTAACGACGATAAATTCATTAAAGGTATTCCCACGAAATTAAAGGAG CTTGAAGGGTTTGACATTTCTTATGATGATTCTAAGAAGATTTCAACGATAAAACTGCCC AATGAATTCCCTCAAGGATCTATTGCCATTTTTGAGACCCAACAGAATGGTGTGGACGAA TCCTTAGATCATTTTATAAGGTCAGGTGCTTTAAAGGCCACTTCAAGTTTGACTCTAGAG TCAATAAATTCCGTCTTGTATCGTAGTGAGCCGGAAGAATACGATGTTAGCGCCGGCGAA GGTGGTGCTTATATTATTCCTAATTTTGGAAAGCCTGTGTATTGTGGTCTGCAAGGTTGG GTTTCCGTATTAAGAAAAATTGTGTTTTATAATGATTTAGCACATCCCCTCAGTGCAAAT TTAAGAAATGGACATTGGGCTTTAGACTACACTATCAGTAGACTTAATTACTATAGCGAT GAAGCAGGAATCAATGAAGTGCAGAACTGGCTGCGTTCAAGGTTTGATAGAGTGAAAAAG TTACCGAGCTACTTAGTGCCCAGTTATTTCGCCTTAATTATCGGCATCCTCTATGGTTGT TGTCGCTTAAAAGCAATACAGCTAATGTCCCGTAATATTGGTAAATCTACATTGTTTGTA CAAAGCTTATCTATGACATCAATCCAGATGGTTTCCAGAATGAAGTCAACCTCTATTTTA CCAGGCGAAAATGTTCCATCTATGGCTGCAGGGTTGCCACACTTTAGCGTAAACTACATG AGATGTTGGGGGAGAGATGTATTCATATCGCTAAGAGGTATGCTATTAACAACAGGTAGA TTTGATGAAGCTAAAGCTCATATACTAGCCTTTGCAAAGACTTTGAAGCATGGTTTAATT CCAAACTTGCTGGATGCCGGTAGAAACCCGAGATATAATGCTCGTGATGCTGCCTGGTTC TTCTTGCAAGCTGTACAGGATTATGTTTATATTGTTCCTGATGGCGAAAAAATATTACAA GAGCAAGTAACAAGGAGATTCCCACTGGATGATACTTACATTCCTGTAGATGATCCAAAG GCATTTAGTTACTCTAGTACCTTGGAGGAGATCATTTATGAAATTTTGAGTAGGCATGCC AAGGGAATTAAATTCAGAGAGGCTAATGCAGGTCCAAATTTAGATCGTGTTATGACTGAT AAAGGGTTTAATGTTGAAATTCATGTCGATTGGTCGACTGGCTTAATTCACGGTGGATCT CAGTATAACTGTGGTACTTGGATGGATAAGATGGGTGAAAGTGAAAAAGCAGGGTCTGTT GGTATTCCTGGAACACCCAGAGATGGAGCCGCAATAGAAATCAATGGGCTTTTAAAAAGT GCTTTAAGGTTTGTTATTGAACTAAACAACAAGGGATTGTTTAAGTTTTCCGATGTGGAG ACGCAGGACGGCGGGAGGATCGATTTCACTGAATGGAATCAATTACTTCAAGACAATTTC GAAAAAAGATATTATGTTCCGGAGGATCCATCACAGGATGCAGATTATGACGTGAGCGCT AAATTGGGTGTTAATAGACGGGGGATATACAGAGATTTGTACAAATCAGGAAAGCCTTAT GAAGATTATCAGTTAAGACCAAATTTTGCCATTGCCATGACTGTGGCACCAGAGTTATTT GTGCCTGAGCATGCCATAAAAGCAATCACCATTGCAGATGAAGTCTTAAGAGGCCCAGTA GGTATGCGTACTTTAGACCCAAGCGATTACAATTACCGTCCGTACTACAACAACGGAGAA GATTCGGATGATTTTGCCACCTCAAAGGGTAGAAACTATCACCAAGGCCCTGAGTGGGTT TGGCTTTACGGCTACTTTTTAAGAGCGTTCCACCATTTCCACTTTAAAACCAGTCCACGT TGTCAGAATGCTGCCAAAGAGAAACCATCCTCTTATTTGTATCAACAATTATACTACAGA TTAAAAGGCCATAGAAAATGGATTTCTGAGAGTGTGTGGGCAGGATTGACAGAGCTAACC AATAAGGATGGTGAAGTATGCAATGACTCAAGCCCCACGCAAGCCTGGAGTTCTGCTTGT TTGTTAGATCTATTTTATGATTTGTGGGATGCCTACGAAGATGATTCCTGA
Protein Properties
Pfam Domain Function
Protein Residues1536
Protein Molecular Weight174970.0
Protein Theoretical pI5.53
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycogen debranching enzyme MNRSLLLRLSDTGEPITSCSYGKGVLTLPPIPLPKDAPKDQPLYTVKLLVSAGSPVARDG LVWTNCPPDHNTPFKRDKFYKKIIHSSFHEDDCIDLNVYAPGSYCFYLSFRNDNEKLETT RKYYFVALPMLYINDQFLPLNSIALQSVVSKWLGSDWEPILSKIAAKNYNMVHFTPLQER GESNSPYSIYDQLQFDQEHFKSPEDVKNLVEHIHRDLNMLSLTDIVFNHTANNSPWLVEH PEAGYNHITAPHLISAIELDQELLNFSRNLKSWGYPTELKNIEDLFKIMDGIKVHVLGSL KLWEYYAVNVQTALRDIKAHWNDESNESYSFPENIKDISSDFVKLASFVKDNVTEPNFGT LGERNSNRINVPKFIQLLKLINDGGSDDSESSLATAQNILNEVNLPLYREYDDDVSEILE QLFNRIKYLRLDDGGPKQGPVTVDVPLTEPYFTRFKGKDGTDYALANNGWIWNGNPLVDF ASQNSRAYLRREVIVWGDCVKLRYGKSPEDSPYLWERMSKYIEMNAKIFDGFRIDNCHST PIHVGEYFLDLARKYNPNLYVVAELFSGSETLDCLFVERLGISSLIREAMQAWSEEELSR LVHKHGGRPIGSYKFVPMDDFSYPADINLNEEHCFNDSNDNSIRCVSEIMIPKILTATPP HALFMDCTHDNETPFEKRTVEDTLPNAALVALCSSAIGSVYGYDEIFPHLLNLVTEKRHY DISTPTGSPSIGITKVKATLNSIRTSIGEKAYDIEDSEMHVHHQGQYITFHRMDVKSGKG WYLIARMKFSDNDDPNETLPPVVLNQSTCSLRFSYALERVGDEIPNDDKFIKGIPTKLKE LEGFDISYDDSKKISTIKLPNEFPQGSIAIFETQQNGVDESLDHFIRSGALKATSSLTLE SINSVLYRSEPEEYDVSAGEGGAYIIPNFGKPVYCGLQGWVSVLRKIVFYNDLAHPLSAN LRNGHWALDYTISRLNYYSDEAGINEVQNWLRSRFDRVKKLPSYLVPSYFALIIGILYGC CRLKAIQLMSRNIGKSTLFVQSLSMTSIQMVSRMKSTSILPGENVPSMAAGLPHFSVNYM RCWGRDVFISLRGMLLTTGRFDEAKAHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWF FLQAVQDYVYIVPDGEKILQEQVTRRFPLDDTYIPVDDPRAFSYSSTLEEIIYEILSRHA KGIKFREANAGPNLDRVMTDKGFNVEIHVDWSTGLIHGGSQYNCGTWMDKMGESEKAGSV GIPGTPRDGAAIEINGLLKSALRFVIELKNKGLFKFSDVETQDGGRIDFTEWNQLLQDNF EKRYYVPEDPSQDADYDVSAKLGVNRRGIYRDLYKSGKPYEDYQLRPNFAIAMTVAPELF VPEHAIKAITIADEVLRGPVGMRTLDPSDYNYRPYYNNGEDSDDFATSKGRNYHQGPEWV WLYGYFLRAFHHFHFKTSPRCQNAAKEKPSSYLYQQLYYRLKGHRKWIFESVWAGLTELT NKDGEVCNDSSPTQAWSSACLLDLFYDLWDAYEDDS
References
External Links
ResourceLink
Saccharomyces Genome Database GDB1
Uniprot IDQ06625
Uniprot NameGDE_YEAST
GenBank Gene IDAB018078
Genebank Protein ID3986291
General Reference
  • Nakayama, A., Yamamoto, K., Tabata, S. (2000). "High expression of glycogen-debranching enzyme in Escherichia coli and its competent purification method." Protein Expr Purif 19:298-303.10873545
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Teste, M. A., Enjalbert, B., Parrou, J. L., Francois, J. M. (2000). "The Saccharomyces cerevisiae YPR184w gene encodes the glycogen debranching enzyme." FEMS Microbiol Lett 193:105-110.11094287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666