You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytidine deaminase
Synonyms
  • CDA
  • Cytidine aminohydrolase
Gene NameCDD1
Enzyme Class
Biological Properties
General FunctionInvolved in zinc ion binding
Specific FunctionThis enzyme scavenge exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis
Cellular LocationCytoplasmic
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
water + hydron + CytidineUridine + Ammonium
water + hydron + 2'-Deoxycytidine2'-Deoxyuridine + Ammonium
Metabolites
YMDB IDNameView
YMDB00051CytidineShow
YMDB00091AmmoniaShow
YMDB00127UridineShow
YMDB00423AmmoniumShow
YMDB005042'-DeoxycytidineShow
YMDB005082'-DeoxyuridineShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
ion binding
cation binding
metal ion binding
catalytic activity
transition metal ion binding
zinc ion binding
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
cytidine deaminase activity
binding
Process
pyrimidine ribonucleoside metabolic process
cytidine metabolic process
metabolic process
nucleoside metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
pyrimidine nucleoside metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR245C
Gene Sequence>429 bp ATGAAAGTAGGTGGCATAGAAGACAGACAACTGGAAGCCTTAAAAAGGGCGGCACTGAAG GCGTGTGAACTCTCCTATAGCCCCTATTCTCACTTCCGTGTCGGTTGTTCCATATTAACA AATAACGATGTTATCTTCACTGGTGCTAATGTCGAGAATGCAAGCTACAGTAATTGTATA TGTGCAGAACGATCTGCTATGATACAAGTTCTAATGGCAGGCCATCGCTCAGGATGGAAA TGCATGGTCATTTGTGGCGATTCTGAGGACCAGTGTGTTTCCCCTTGCGGCGTTTGCAGG CAGTTTATCAATGAATTTGTGGTCAAGGACTTTCCAATAGTCATGCTTAATTCCACAGGT TCTCGTTCTAAAGTCATGACAATGGGAGAACTGCTGCCCATGGCTTTTGGTCCATCTCAT TTAAACTAG
Protein Properties
Pfam Domain Function
Protein Residues142
Protein Molecular Weight15535.90039
Protein Theoretical pI7.22
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytidine deaminase MKVGGIEDRQLEALKRAALKACELSYSPYSHFRVGCSILTNNDVIFTGANVENASYSNCI CAERSAMIQVLMAGHRSGWKCMVICGDSEDQCVSPCGVCRQFINEFVVKDFPIVMLNSTG SRSKVMTMGELLPMAFGPSHLN
References
External Links
ResourceLink
Saccharomyces Genome Database CDD1
Uniprot IDQ06549
Uniprot NameCDD_YEAST
GenBank Gene IDAF080089
Genebank Protein ID4140396
PDB ID
1R5T
General Reference
  • Kurtz, J. E., Exinger, F., Erbs, P., Jund, R. (1999). "New insights into the pyrimidine salvage pathway of Saccharomyces cerevisiae: requirement of six genes for cytidine metabolism." Curr Genet 36:130-136.10501935
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Xie, K., Sowden, M. P., Dance, G. S., Torelli, A. T., Smith, H. C., Wedekind, J. E. (2004). "The structure of a yeast RNA-editing deaminase provides insight into the fold and function of activation-induced deaminase and APOBEC-1." Proc Natl Acad Sci U S A 101:8114-8119.15148397