You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLysophosphatidylcholine acyltransferase
Synonyms
  • 1-acylglycerophosphocholine O-acyltransferase
  • Tafazzin homolog
  • lyso-PC acyltransferase
Gene NameTAZ1
Enzyme Class
Biological Properties
General FunctionInvolved in acyltransferase activity
Specific FunctionAcyltransferase which mediates the conversion of 1-acyl- sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC). Displays a broad LPC fatty acyl chain substrate specificity utilizing LPC molecules ranging in length from C-10 to C-20. Does not utilize other lysolipids than LPC as acceptor. Also shows acyl-CoA-independent acyltransferase activity. Required for normal phospholipid content of mitochondrial membranes. Involved in the remodeling of the acyl groups of cardiolipin in the mitochondrial inner membrane, which affects the assembly and stability of respiratory chain complex IV and its supercomplex forms
Cellular LocationMitochondrion outer membrane; Single-pass membrane protein; Intermembrane side (Potential)
SMPDB Pathways
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol biosynthesis through mitochondriaPW007513 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
DG + PC → TG + LysoPC
KEGG Reactions
1-O-acylglycerophosphocholine + fatty acid ↔ phosphatidylcholine + water
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR140W
Gene Sequence>1146 bp ATGTCTTTTAGGGATGTCCTAGAAAGAGGATATGAATTTTTAGAAGCCTATCCCAGAAGA AGCCCCCTTTGGAGATTTCTTTCATACAGTACATCATTACTGACCTTCGGTGTATCAAAA CTGCTTCTTTTCACATGCTATAATGTCAAATTGAATGGTTTTGAAAAATTAGAAACTGCC TTGGAACGTTCCAAAAGGGAAAATAGAGGCCTTATGACGGTCATGAACCATATGAGTATG GTCGATGATCCGTTAGTTTGGGCAACACTACCATATAAGTTATTTACGTCTTTGGACAAC ATAAGATGGTCTTTGGGTGCACATAATATTTGCTTTCAAAATAAATTTCTGGCCAACTTT TTCTCACTTGGCCAAGTCCTTTCAACAGAAAGATTTGGGGTGGGCCCATTTCAAGGTTCT ATAGATGCTTCAATAAGATTGTTAAGCCCTGACGACACTTTAGACTTGGAATGGACCCCT CACTCTGAGGTCTCTTCTTCGCTAAAAAAAGCCTACTCCCCGCCCATAATAAGGTCGAAG CCATCTTGGGTCCATGTTTATCCAGAAGGATTTGTACTACAATTATATCCGCCTTTTGAA AATTCGATGAGGTATTTTAAATGGGGTATTACCAGAATGATCCTAGAAGCAACAAAGCCG CCCATTGTAGTACCAATATTTGCTACAGGGTTTGAAAAAATAGCATCCGAAGCAGTCACA GATTCAATGTTTAGACAAATTCTACCAAGAAACTTTGGCTCTGAAATAAATGTTACCATA GGGGATCCTTTAAATGATGATTTAATCGACAGGTATAGAAAAGAATGGACACATTTGGTT GAAAAATACTATGATCCCAAAAATCCTAACGACCTCTCTGACGAATTGAAATATGGTAAA GAGGCGCAAGATTTAAGAAGCAGATTAGCCGCTGAACTGAGAGCCCATGTTGCTGAAATT AGAAATGAAGTTCGCAAATTACCACGCGAAGACCCTAGGTTCAAATCCCCCTCATGGTGG AAGCGGTTCAACACCACGGAAGGTAAATCGGACCCAGATGTTAAAGTCATTGGCGAAAAT TGGGCAATAAGGAGGATGCAAAAGTTTCTGCCTCCAGAGGGTAAACCAAAGGGTAAGGAT GATTGA
Protein Properties
Pfam Domain Function
Protein Residues381
Protein Molecular Weight44187.19922
Protein Theoretical pI9.11
Signalling Regions
  • None
Transmembrane Regions
  • 26-47
Protein Sequence>Lysophosphatidylcholine acyltransferase MSFRDVLERGDEFLEAYPRRSPLWRFLSYSTSLLTFGVSKLLLFTCYNVKLNGFEKLETA LERSKRENRGLMTVMNHMSMVDDPLVWATLPYKLFTSLDNIRWSLGAHNICFQNKFLANF FSLGQVLSTERFGVGPFQGSIDASIRLLSPDDTLDLEWTPHSEVSSSLKKAYSPPIIRSK PSWVHVYPEGFVLQLYPPFENSMRYFKWGITRMILEATKPPIVVPIFATGFEKIASEAVT DSMFRQILPRNFGSEINVTIGDPLNDDLIDRYRKEWTHLVEKYYDPKNPNDLSDELKYGK EAQDLRSRLAAELRAHVAEIRNEVRKLPREDPRFKSPSWWKRFNTTEGKSDPDVKVIGEN WAIRRMQKFLPPEGKPKGKDD
References
External Links
ResourceLink
Saccharomyces Genome Database TAZ1
Uniprot IDQ06510
Uniprot NameTAZ1_YEAST
GenBank Gene IDAY692739
Genebank Protein ID51012929
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Richard, M. G., McMaster, C. R. (1998). "Lysophosphatidylcholine acyltransferase activity in Saccharomyces cerevisiae: regulation by a high-affinity Zn2+ binding site." Lipids 33:1229-1234.9930410
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Gu, Z., Valianpour, F., Chen, S., Vaz, F. M., Hakkaart, G. A., Wanders, R. J., Greenberg, M. L. (2004). "Aberrant cardiolipin metabolism in the yeast taz1 mutant: a model for Barth syndrome." Mol Microbiol 51:149-158.14651618
  • Testet, E., Laroche-Traineau, J., Noubhani, A., Coulon, D., Bunoust, O., Camougrand, N., Manon, S., Lessire, R., Bessoule, J. J. (2005). "Ypr140wp, 'the yeast tafazzin', displays a mitochondrial lysophosphatidylcholine (lyso-PC) acyltransferase activity related to triacylglycerol and mitochondrial lipid synthesis." Biochem J 387:617-626.15588229
  • Brandner, K., Mick, D. U., Frazier, A. E., Taylor, R. D., Meisinger, C., Rehling, P. (2005). "Taz1, an outer mitochondrial membrane protein, affects stability and assembly of inner membrane protein complexes: implications for Barth Syndrome." Mol Biol Cell 16:5202-5214.16135531