Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLysophosphatidic acid:oleoyl-CoA acyltransferase 1
Synonyms
  • LPAAT
  • Lysophosphatidic acid acyltransferase
  • Vacuolar protein sorting-associated protein 66
Gene NameLOA1
Enzyme ClassNot Available
Biological Properties
General Functionlipid particle organization
Specific FunctionAcyl-CoA-dependent lysophosphatidic acid acyltransferase with preference for oleoyl-CoA. Involved in triacylglyceride homeostasis and lipid droplet formation. Involved in vacuolar protein sorting.
Cellular LocationNot Available
SMPDB Pathways
Cardiolipin BiosynthesisPW002431 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/28:0)PW003484 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/30:0)PW003501 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/26:0)PW003502 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:0)PW003503 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
oleoyl-CoA + 1-oleyl-2-lyso-phosphatidateCoenzyme A + PA(18:1(9Z)/18:1(9Z))
PA(16:0/0:0) + Palmityl-CoACoenzyme A + PA(16:0/16:0)
PA(16:0/0:0) + Palmityl-CoADG(16:0/16:0/0:0) + Coenzyme A
PA(16:0/0:0) + Palmitic acidPA(16:0/16:0) + Coenzyme A
PA(16:0/0:0) + Palmityl-CoA Coenzyme A + PA(16:0/16:0)
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00069Palmitic acidShow
YMDB00301Palmityl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB01127DG(16:0/16:0/0:0)Show
YMDB01160PA(16:0/0:0)Show
YMDB01161PA(16:0/16:0)Show
YMDB163021-oleyl-2-lyso-phosphatidateShow
GO Classification
Function
integral component of membrane
endoplasmic reticulum membrane
lipid metabolic process
endoplasmic reticulum
lipid particle
lipid particle organization
1-acylglycerol-3-phosphate O-acyltransferase activity
lysophosphatidic acid acyltransferase activity
cellular triglyceride homeostasis
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>903 bp ATGGAAAAGTACACCAATTGGAGAGACAATGGTACGGGAATAGCTCCATTTCTACCAAAC ACAATCAGGAAACCTAGTAAGGTGATGACAGCGTGTTTGTTGGGTATCCTAGGGGTGAAA ACCATTATAATGCTACCATTGATTATGCTGTACCTTCTAACTGGCCAGAACAACTTACTG GGTTTGATATTGAAGTTTACATTCAGTTGGAAAGAGGAAATTACCGTGCAAGGAATCAAG AAACGTGACGTAAGGAAATCCAAGCATTATCCACAGAAGGGCAAGCTTTATATTTGCAAT TGTACCTCACCTTTAGATGCTTTTTCAGTGGTGTTATTAGCTCAAGGGCCTGTTACGTTG TTGGTCCCATCCAATGACATTGTATACAAAGTTTCCATAAGAGAATTCATCAACTTCATC CTCGCCGGTGGGTTAGATATAAAACTCTATGGCCACGAGGTAGCAGAGCTATCTCAATTG GGCAATACCGTGAATTTTATGTTTGCTGAGGGTACCTCATGTAATGGTAAAAGCGTCTTA CCGTTTAGTATAACCGGGAAAAAACTTAAAGAATTCATAGACCCTTCAATAACCACAATG AACCCCGCAATGGCCAAAACTAAAAAATTTGAATTGCAGACCATCCAAATCAAAACTAAT AAAACTGCCATCACCACATTGCCCATCTCCAATATGGAGTATTTATCTAGATTTCTGAAC AAGGGCATTAATGTTAAATGCAAGATCAACGAGCCACAAGTACTCTCGGATAATTTAGAG GAATTACGCGTTGCATTAAACGGTGGCGACAAATATAAACTAGTCTCACGGAAGTTAGAT GTTGAATCTAAGAGGAATTTTGTGAAGGAATATATCAGCGATCAACGTAAAAAGAGGAAG TAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues300
Protein Molecular Weight33815.635
Protein Theoretical pINot Available
Signalling RegionsNot Available
Transmembrane Regions
  • 33-53
Protein Sequence>Lysophosphatidic acid:oleoyl-CoA acyltransferase 1 MEKYTNWRDNGTGIAPFLPNTIRKPSKVMTACLLGILGVKTIIMLPLIMLYLLTGQNNLL GLILKFTFSWKEEITVQGIKKRDVRKSKHYPQKGKLYICNCTSPLDAFSVVLLAQGPVTL LVPSNDIVYKVSIREFINFILAGGLDIKLYGHEVAELSQLGNTVNFMFAEGTSCNGKSVL PFSITGKKLKEFIDPSITTMNPAMAKTKKFELQTIQIKTNKTAITTLPISNMEYLSRFLN KGINVKCKINEPQVLSDNLEELRVALNGGDKYKLVSRKLDVESKRNFVKEYISDQRKKRK
References
External Links
ResourceLink
Saccharomyces Genome Database LOA1
Uniprot IDQ06508
Uniprot NameLOA1
General ReferenceNot Available