You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLysophosphatidic acid:oleoyl-CoA acyltransferase 1
Synonyms
  • LPAAT
  • Lysophosphatidic acid acyltransferase
  • Vacuolar protein sorting-associated protein 66
Gene NameLOA1
Enzyme ClassNot Available
Biological Properties
General Functionlipid particle organization
Specific FunctionAcyl-CoA-dependent lysophosphatidic acid acyltransferase with preference for oleoyl-CoA. Involved in triacylglyceride homeostasis and lipid droplet formation. Involved in vacuolar protein sorting.
Cellular LocationNot Available
SMPDB Pathways
Cardiolipin BiosynthesisPW002431 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/28:0)PW003484 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/30:0)PW003501 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/26:0)PW003502 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:0)PW003503 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
oleoyl-CoA + 1-oleyl-2-lyso-phosphatidateCoenzyme A + PA(18:1(9Z)/18:1(9Z))
PA(16:0/0:0) + Palmityl-CoACoenzyme A + PA(16:0/16:0)
PA(16:0/0:0) + Palmityl-CoADG(16:0/16:0/0:0) + Coenzyme A
PA(16:0/0:0) + Palmitic acidPA(16:0/16:0) + Coenzyme A
PA(16:0/0:0) + Palmityl-CoA Coenzyme A + PA(16:0/16:0)
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00069Palmitic acidShow
YMDB00301Palmityl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB01127DG(16:0/16:0/0:0)Show
YMDB01160PA(16:0/0:0)Show
YMDB01161PA(16:0/16:0)Show
YMDB163021-oleyl-2-lyso-phosphatidateShow
GO Classification
Function
lipid particle organization
1-acylglycerol-3-phosphate O-acyltransferase activity
lysophosphatidic acid acyltransferase activity
cellular triglyceride homeostasis
integral component of membrane
endoplasmic reticulum membrane
lipid metabolic process
endoplasmic reticulum
lipid particle
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>903 bp ATGGAAAAGTACACCAATTGGAGAGACAATGGTACGGGAATAGCTCCATTTCTACCAAAC ACAATCAGGAAACCTAGTAAGGTGATGACAGCGTGTTTGTTGGGTATCCTAGGGGTGAAA ACCATTATAATGCTACCATTGATTATGCTGTACCTTCTAACTGGCCAGAACAACTTACTG GGTTTGATATTGAAGTTTACATTCAGTTGGAAAGAGGAAATTACCGTGCAAGGAATCAAG AAACGTGACGTAAGGAAATCCAAGCATTATCCACAGAAGGGCAAGCTTTATATTTGCAAT TGTACCTCACCTTTAGATGCTTTTTCAGTGGTGTTATTAGCTCAAGGGCCTGTTACGTTG TTGGTCCCATCCAATGACATTGTATACAAAGTTTCCATAAGAGAATTCATCAACTTCATC CTCGCCGGTGGGTTAGATATAAAACTCTATGGCCACGAGGTAGCAGAGCTATCTCAATTG GGCAATACCGTGAATTTTATGTTTGCTGAGGGTACCTCATGTAATGGTAAAAGCGTCTTA CCGTTTAGTATAACCGGGAAAAAACTTAAAGAATTCATAGACCCTTCAATAACCACAATG AACCCCGCAATGGCCAAAACTAAAAAATTTGAATTGCAGACCATCCAAATCAAAACTAAT AAAACTGCCATCACCACATTGCCCATCTCCAATATGGAGTATTTATCTAGATTTCTGAAC AAGGGCATTAATGTTAAATGCAAGATCAACGAGCCACAAGTACTCTCGGATAATTTAGAG GAATTACGCGTTGCATTAAACGGTGGCGACAAATATAAACTAGTCTCACGGAAGTTAGAT GTTGAATCTAAGAGGAATTTTGTGAAGGAATATATCAGCGATCAACGTAAAAAGAGGAAG TAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues300
Protein Molecular Weight33815.635
Protein Theoretical pINot Available
Signalling RegionsNot Available
Transmembrane Regions
  • 33-53
Protein Sequence>Lysophosphatidic acid:oleoyl-CoA acyltransferase 1 MEKYTNWRDNGTGIAPFLPNTIRKPSKVMTACLLGILGVKTIIMLPLIMLYLLTGQNNLL GLILKFTFSWKEEITVQGIKKRDVRKSKHYPQKGKLYICNCTSPLDAFSVVLLAQGPVTL LVPSNDIVYKVSIREFINFILAGGLDIKLYGHEVAELSQLGNTVNFMFAEGTSCNGKSVL PFSITGKKLKEFIDPSITTMNPAMAKTKKFELQTIQIKTNKTAITTLPISNMEYLSRFLN KGINVKCKINEPQVLSDNLEELRVALNGGDKYKLVSRKLDVESKRNFVKEYISDQRKKRK
References
External Links
ResourceLink
Saccharomyces Genome Database LOA1
Uniprot IDQ06508
Uniprot NameLOA1
General ReferenceNot Available