You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameThiamine biosynthesis protein THI22
SynonymsNot Available
Gene NameTHI22
Enzyme ClassNot Available
Biological Properties
General FunctionCoenzyme transport and metabolism
Specific FunctionEssential for thiamine biosynthesis
Cellular LocationSecreted (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + 4-amino-5-hydroxymethyl-2-methylpyrimidine4-amino-2-methyl-5-phosphomethylpyrimidine + hydron + ADP
4-amino-2-methyl-5-phosphomethylpyrimidine + Adenosine triphosphate4-amino-2-methyl-5-diphosphomethylpyrimidine + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB001174-amino-2-methyl-5-diphosphomethylpyrimidineShow
YMDB001184-amino-5-hydroxymethyl-2-methylpyrimidineShow
YMDB001284-amino-2-methyl-5-phosphomethylpyrimidineShow
YMDB00862hydronShow
YMDB00914ADPShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 16
LocusYPR121W
Gene Sequence>1719 bp ATGGTTATCATCCTCCTAGGTCTTTGCACATTAGGTTTTCCAAGAACAGCATTCTGTCCC TCCATAATGACAAATTCTACAGTGAGTATTAACACGCCTCCACCATATCTTACTCTAGCT TGTAATGAAAAATTACCAACAGTTATGTCAATTGCTGGATCAGACTCAAGTGGTGGAGCC GGTGTTGAAGCTGATATTAAGACTATCACCGCACACAGATGTTATGCCATGACATGCGTC ACTACTTTGACTGCTCAAACTCCAGTGAAGGTGTACGGCGCTCATAATATACCAAAGAAA ATGGTATCTCAAATATTAGACGCCAATTTACAGGACATGAAATGTAATGTTATTAAGACT GGCATGCTTACGGTGGATGCAATCGAAGTCTTGCACGAAAAACTTTTGCAACTTGGTGAA AATAGACCCAAGTTAGTAATTGATCCAGTTCTTTGCGCCGCTTCTGACTCTTCTCCAACT GGAAAGGATGTGGTTAGCTTAATCATAGAAAAAATTTCTCCTTTTGCCGACATTTTAACT CCTAACATTTCAGACTGTTTCATGTTACTGGGCGAGAACAGAGAAGTTAGCAAACTACAA GACGTTCTTGAAATCGCGAAAGACCTTTCTAGAATCACCAATTGCTCCAATATTTTAGTG AAGGGAGGCCACATTCCATGTGACGATGGAAAAGAAAAGCATATTACTGACGTTCTTTAC TTAGGTGCTGAACAAAAATTCATCACTTTTAAGGGCCAATTCGTTAATACTACACGCACT CATGGCGCTGGATGCACACTGGCTTCTGCTATAGCATCTAACTTGGCTCGCGGTTATTCT CTTTCCCAATCTGTTTATGGTGGTATTGAGTATGTACAGAATGCCATCGCAATTGGCTGT GACGTTACCAAGAAAGCTGTGAAGGTTGGACCAATTAATCACGTTTACGCCGTAGAGATT CCATTAGAAAAAATGCTCACCGACGAATGCTTTACAGCATCTGATGCTGTACCTAAGAAG CCAATCGAAGGTTCTCTTGACAAAATCCCTGGGGGTAGCTTCTTTAATTATCTGATAAAT CATCCTAAAGTCAAGCCGCATTGGGATGCCTACGTGAATCACGAATTTGTTAAAAGAGTG GCAGACGGCACATTGGAACGCAAAAAGTTCCAGTTTTTTATTGAACAAGATTATTTATAC TTAATTGATTATGTGAGAGTTTGCTGCGTCACAGGTAGTAAATCTCCAACTCTAGAAGAT CTAGAAAAGGACCTTGTTATTGCTGATTGCGCCCGTAATGAACTAAATGAACATGAAAGA AGATTAAGAGAAGAATTTGGAGTTAAGGACCCAGATTACTTACAAAAAATTAAGAGAGGT CCCGCATTAAGGGCCTACTGTCGTTACCTAATTGACATTTCCAGAAGAGGAAACTGGCAA GAAATAGTTGTAGCCCTCAACCCTTGTCTAATGGGTTATGTTTATGCTGTAGACAAAGTT AAGGATAAGATAACAGCAGCAGAGGGTTCTATTTATAGTGAATGGTGTGATACTTGCGCG TCTTCATTTTGCTACCAAGCTGTGCTTGAAGGTGAAAGGCTCATGAATCACATCTTGGAA ACATATCCTCCAGATCAACTTGATTCTTTGGTGACGATCTTTGCAAGAGGTTGTGAATTA GAAACTAATTTCTGGACCGCCGCCATGGAATACGAATGA
Protein Properties
Pfam Domain Function
Protein Residues572
Protein Molecular Weight63306.39844
Protein Theoretical pI5.81
Signalling Regions
  • 1-19
Transmembrane Regions
  • None
Protein Sequence>Thiamine biosynthesis protein THI22 MVIILLGLCTLGFPRTAFCPSIMTNSTVSINTPPPYLTLACNEKLPTVMSIAGSDSSGGA GVEADIKTITAHRCYAMTCVTTLTAQTPVKVYGAHNIPKKMVSQILDANLQDMKCNVIKT GMLTVDAIEVLHEKLLQLGENRPKLVIDPVLCAASDSSPTGKDVVSLIIEKISPFADILT PNISDCFMLLGENREVSKLQDVLEIAKDLSRITNCSNILVKGGHIPCDDGKEKHITDVLY LGAEQKFITFKGQFVNTTRTHGAGCTLASAIASNLARGYSLSQSVYGGIEYVQNAIAIGC DVTKKAVKVGPINHVYAVEIPLEKMLTDECFTASDAVPKKPIEGSLDKIPGGSFFNYLIN HPKVKPHWDAYVNHEFVKRVADGTLERKKFQFFIEQDYLYLIDYVRVCCVTGSKSPTLED LEKDLVIADCARNELNEHERRLREEFGVKDPDYLQKIKRGPALRAYCRYLIDISRRGNWQ EIVVALNPCLMGYVYAVDKVKDKITAAEGSIYSEWCDTCASSFCYQAVLEGERLMNHILE TYPPDQLDSLVTIFARGCELETNFWTAAMEYE
References
External Links
ResourceLink
Saccharomyces Genome Database THI22
Uniprot IDQ06490
Uniprot NameTHI22_YEAST
GenBank Gene IDU40828
Genebank Protein ID1066472
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Llorente, B., Fairhead, C., Dujon, B. (1999). "Genetic redundancy and gene fusion in the genome of the Baker's yeast Saccharomyces cerevisiae: functional characterization of a three-member gene family involved in the thiamine biosynthetic pathway." Mol Microbiol 32:1140-1152.10383756