You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative hexokinase YLR446W
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionATP + D-hexose = ADP + D-hexose 6-phosphate
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Fructose and mannose metabolismec00051 Map00051
Galactose metabolismec00052 Map00052
Glycolysis / Gluconeogenesisec00010 Map00010
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Adenosine triphosphate + D-FructoseADP + Beta-D-Fructose 6-phosphate
Adenosine triphosphate + D-MannoseADP + Mannose 6-phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00072D-GalactoseShow
YMDB00109Adenosine triphosphateShow
YMDB00242Mannose 6-phosphateShow
YMDB00657D-FructoseShow
YMDB00894D-MannoseShow
YMDB00914ADPShow
YMDB00947Glucose 6-phosphateShow
YMDB16176Beta-D-Fructose 6-phosphateShow
GO Classification
Component
Not Available
Function
adenyl ribonucleotide binding
ATP binding
phosphotransferase activity, alcohol group as acceptor
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYLR446W
Gene Sequence>1302 bp ATGACAATTGAAAGCACTCTAGCTCGGGAATTAGAAAGCTTGATTTTACCCGCTGATTCC ATAGTGAATGTAGTTGACCAATTCCAAGAGGAGTTGTTATCACGGCTTCAGACAAATACG ATTTCTATGCTCCCGCAGTGTTTAGTCCCAGATGAACGATCGCGATGGAACCCTGAAGAC AAAATTCTGACCATTGATTTCGGCGGGACAAGACTGAAATTTGCAATTATCTCTCTGCCC CAAATCGTTATCGAATACAATGATGCCTTCGAACTTACCTACAACATCGTTGATTCGAAT TTCTTTAATCAAATCATCTATACAATATGTACCAGGCTGGCTGCAAATGGTTATATAAAA AAAAAGAACGAGTCATCTGAGGCGTCTAAATTTTTTGTTTCCGTGACATTCAGTTTTCCT CTAAATCCAGAAGGGGAGGTAGTTGCAATGGGAAAAGGATTTGTGATGACTGACACCCTT CAAGGATCCACGGTGAAACAGCTCATCCAATCTTCCTTTCACCGGATTATATCAGAAAAT ATCGAAGAATTTTTCTGTACCATGAACGTGTGTCATGTAATAAACGATGCAATTGCAGTT TCACTAACAAGCAAATTTATATGCGAAAACGATTCCATCTCATTAATAATAGGAACTGGT ACAAATGCATGTTTTGAGGTTCCATACGGATATTTACCACCTTTCAAGAGAGATGCCCTG AGAGAAACATTACCGTCAAGCTATAATAAGGAGACATTAAATTTCAAACATGTTCTCATT AATTCTGAAATTGGCTTTATTGGTAAAAATGTCATTGCATTGCAACCGTTTGACATTCAT GGAGCAATCTCATACGAAATGCCACTAGAGTGCGTTACTTCTGGTAAATGGCTTCCCCTA TCATTAAAAAATATTCTATTGCAATATAACATAATCCCCAAAAACTTCCCAGTAGAGTTC AATGGGGAACTGGTATGCCAGCTGGCAGAAGACTGTACTAATGCTTGGTTCGAAAACGAA CATTATGCACTAATTTGTCAGATCGCACGACTATTAATCAAGAGAGCCGCATTTTATGTT GCTGCAATTGTACAAGCTATTGATATCATCACAGGCTGCAAAAACTATAACTTTATTCAT ATTGGCTACGTTGGATCCTTTCTCCACAATTCAAATTTTTATCGAGAGCAGATAAAATAT TACTCCAGCATACATATTAAGTTGCAATTCTTAAATCACAGTAATCTTCTAGGCGCTGCA ATAGCCACCTACTTGAACAAATCAGACAACCAAGTTCAATAA
Protein Properties
Pfam Domain Function
Protein Residues433
Protein Molecular Weight48968.80078
Protein Theoretical pI5.63
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative hexokinase YLR446W MTIESTLARELESLILPADSIVNVVDQFQEELLSRLQTNTISMLPQCLVPDKRSRWNPED KILTIDFGGTRLKFAIISLPQIVIEYNDAFELTYNIVDSNFFNQIIYTICTRLAANGYIK KKNESSEASKFFVSVTFSFPLNPEGEVVAMGKGFVMTDTLQGSTVKQLIQSSFHRIISEN IEEFFCTMNVCHVINDAIAVSLTSKFICENDSISLIIGTGTNACFEVPYGYLPPFKRDAL RETLPSSYNKETLNFKHVLINSEIGFIGKNVIALQPFDIHGAISYEMPLECVTSGKWLPL SLKNILLQYNIIPKNFPVEFNGELVCQLAEDCTNAWFENEHYALICQIARLLIKRAAFYV AAIVQAIDIITGCKNYNFIHIGYVGSFLHNSNFYREQIKYYSSIHIKLQFLNHSNLLGAA IATYLNKSDNQVQ
References
External Links
ResourceLink
Saccharomyces Genome Database YLR446W
Uniprot IDQ06204
Uniprot NameYL446_YEAST
GenBank Gene IDAY692639
Genebank Protein ID51012729
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287