Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSphingoid long chain base kinase 5
Synonyms
  • LCB kinase 5
  • Sphinganine kinase 5
Gene NameLCB5
Enzyme Class
Biological Properties
General FunctionInvolved in diacylglycerol kinase activity
Specific FunctionCatalyzes the phosphorylation of the sphingoid long chain bases dihydrosphingosine (DHS or sphinganine) and phytosphingosine (PHS) to form dihydrosphingosine 1-phosphate (DHS-1P) and phytosphingosine 1-phosphate (PHS-1P) respectively. Redundant to LCB4, is only responsible for few percent of the total activity. Involved in the biosynthesis of sphingolipids and ceramides. Involved in heat-induced transient cell cycle arrest. Accumulation of phosphorylated sphingoid long chain bases (LCBPs) stimulates calcium influx and activates calcineurin signaling. Involved in heat-stress resistance
Cellular LocationGolgi apparatus membrane; Peripheral membrane protein
SMPDB Pathways
Sphingolipid metabolismPW002479 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Sphingolipid metabolismec00600 Map00600
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + PhytosphingosinePhytosphingosine 1-phosphate + hydron + ADP
Sphinganine + Adenosine triphosphatehydron + Sphinganine 1-phosphate + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00190SphingosineShow
YMDB00285PhytosphingosineShow
YMDB00299Sphinganine 1-phosphateShow
YMDB00327SphinganineShow
YMDB00762Phytosphingosine 1-phosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
diacylglycerol kinase activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
G-protein coupled receptor protein signaling pathway
activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway
Gene Properties
Chromosome Locationchromosome 12
LocusYLR260W
Gene Sequence>2064 bp ATGACTTTGAAACCTTCAAAGAGACGTAAGGGCAGGTCTCGCCATTCCAGGAAGAAGCAA ATAACGTCAGCGATACTGACTGAGGAAGGAATAATGATCAAGGCAAAACCATCAAGTCCT TACACATACGCAAATAGAATGGCAGATAAACGAAGTCGCAGCAGCATTGACAACATCAGT AGAACTAGCTTTCAAAGCAACATCAGTAGAACTAGCTTTCAAAGCAACAGTGATAACAAC AGTATATTTGAAACGGCTTCACTAATTAGCTGTGTTACCTGTTTAAGCGATACTGATACA ATAGACAGATCGGAAACATCGACAACGGATACAAGTAAAGATGATCTTTCTGCTAATCCA AAACTTCATTATCCTTCGGTGAATGGTCAATTGCCAGCAAACACCGTTATCCCCTATGGA CGAATTCTGGATGCCAGATACATTGAAAAGGAACCTCTGCATTATTATGATGCCAATTCA TCACCCAGTTCACCTTTAAGCAGCTCAATGAGTAACATTAGTGAAAAGTGTGATCTTGAT GAATTAGAGTCTTCCCAAAAAAAAGAAAGGAAGGGCAACTCGCTATCGCGAGGAAGTAAC AGTAGTAGTAGCCTCCTGACTTCCAGATCTCCTTTTACGAAACTAGTAGAGGTTATATTT GCTAGGCCAAGACGGCATGACGTTGTACCCAAAAGGGTTTCATTGTATATTGACTATAAA CCCCATTCATCTTCTCACTTAAAAGAAGAAGATGACTTGGTTGAGGAGATTTTAAAGAGA AGCTACAAAAACACTAGAAGGAACAAATCCATATTTGTGATCATTAATCCGTTTGGTGGT AAAGGTAAGGCGAAAAAACTGTTTATGACAAAGGCAAAGCCGTTACTATTAGCAAGTCGG TGTTCCATAGAAGTGGTTTATACAAAATACCCTGGTCATGCTATAGAGATCGCGCGGGAA ATGGATATTGACAAATATGACACTATTGCTTGCGCTTCGGGAGATGGCATTCCTCATGAG GTGATCAATGGGTTATACCAAAGGCCTGATCATGTCAAAGCATTCAACAATATCGCCATT ACAGAAATTCCATGCGGATCAGGTAACGCAATGAGCGTATCCTGCCACTGGACAAACAAT CCTTCGTACTCAACTTTATGCTTAATTAAATCGATAGAGACTAGAATTGATTTGATGTGT TGTTCGCAGCCTTCTTATGCAAGAGAGCACCCAAAGTTATCATTTTTAAGTCAAACATAT GGTCTCATTGCAGAAACTGACATAAACACTGAATTTATTAGATGGATGGGACCTGCAAGG TTTGAATTGGGTGTAGCCTTCAATATCATACAAAAAAAAAAATATCCTTGTGAGATATAT GTAAAGTATGCTGCCAAATCAAAAAACGAGTTAAAAAATCATTACCTGGAACACAAAAAT AAAGGGTCGTTAGAATTCCAGCATATTACTATGAACAAAGATAACGAGGATTGTGATAAT TACAATTACGAAAATGAATACGAAACCGAAAACGAAGATGAAGATGAAGATGCGGATGCG GATGACGAAGACTCCCACTTGATATCTCGTGATCTGGCAGATTCTAGTGCTGATCAAATT AAAGAGGAAGATTTCAAAATAAAATATCCATTAGATGAAGGTATCCCTAGTGACTGGGAA AGATTGGATCCTAATATTTCGAACAACCTAGGTATCTTCTATACGGGTAAAATGCCATAT GTGGCTGCTGACACTAAATTCTTTCCGGCAGCGCTTCCTTCAGATGGTACAATGGATATG GTTATCACCGATGCAAGAACCTCGTTGACGAGGATGGCACCAATCCTGCTGGGACTAGAT AAGGGTTCCCATGTTTTACAACCGGAAGTCTTACACTCTAAAATTTTGGCATACAAGATA ATACCAAAGCTAGGGAACGGCTTGTTCTCTGTCGATGGCGAGAAATTTCCTCTAGAGCCC CTTCAAGTCGAAATTATGCCACGCTTATGCAAGACGTTACTGAGAAATGGCCGTTATGTG GACACAGATTTCGATTCTATGTGA
Protein Properties
Pfam Domain Function
Protein Residues687
Protein Molecular Weight77564.60156
Protein Theoretical pI6.86
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Sphingoid long chain base kinase 5 MTLKPSKRRKGRSRHSRKKQITSAILTEEGIMIKAKPSSPYTYANRMADKRSRSSIDNIS RTSFQSNISRTSFQSNSDNNSIFETASLISCVTCLSDTDTIDRSETSTTDTSKDDLSANP KLHYPSVNGQLPANTVIPYGRILDARYIEKEPLHYYDANSSPSSPLSSSMSNISEKCDLD ELESSQKKERKGNSLSRGSNSSSSLLTSRSPFTKLVEVIFARPRRHDVVPKRVSLYIDYK PHSSSHLKEEDDLVEEILKRSYKNTRRNKSIFVIINPFGGKGKAKKLFMTKAKPLLLASR CSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPHEVINGLYQRPDHVKAFNNIAI TEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSIETRIDLMCCSQPSYAREHPKLSFLSQTY GLIAETDINTEFIRWMGPARFELGVAFNIIQKKKYPCEIYVKYAAKSKNELKNHYLEHKN KGSLEFQHITMNKDNEDCDNYNYENEYETENEDEDEDADADDEDSHLISRDLADSSADQI KEEDFKIKYPLDEGIPSDWERLDPNISNNLGIFYTGKMPYVAADTKFFPAALPSDGTMDM VITDARTSLTRMAPILLGLDKGSHVLQPEVLHSKILAYKIIPKLGNGLFSVDGEKFPLEP LQVEIMPRLCKTLLRNGRYVDTDFDSM
References
External Links
ResourceLink
Saccharomyces Genome Database LCB5
Uniprot IDQ06147
Uniprot NameLCB5_YEAST
GenBank Gene IDU17244
Genebank Protein ID577178
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Nagiec, M. M., Skrzypek, M., Nagiec, E. E., Lester, R. L., Dickson, R. C. (1998). "The LCB4 (YOR171c) and LCB5 (YLR260w) genes of Saccharomyces encode sphingoid long chain base kinases." J Biol Chem 273:19437-19442.9677363
  • Kim, S., Fyrst, H., Saba, J. (2000). "Accumulation of phosphorylated sphingoid long chain bases results in cell growth inhibition in Saccharomyces cerevisiae." Genetics 156:1519-1529.11102354
  • Jenkins, G. M., Hannun, Y. A. (2001). "Role for de novo sphingoid base biosynthesis in the heat-induced transient cell cycle arrest of Saccharomyces cerevisiae." J Biol Chem 276:8574-8581.11056159
  • Birchwood, C. J., Saba, J. D., Dickson, R. C., Cunningham, K. W. (2001). "Calcium influx and signaling in yeast stimulated by intracellular sphingosine 1-phosphate accumulation." J Biol Chem 276:11712-11718.11278643
  • Funato, K., Lombardi, R., Vallee, B., Riezman, H. (2003). "Lcb4p is a key regulator of ceramide synthesis from exogenous long chain sphingoid base in Saccharomyces cerevisiae." J Biol Chem 278:7325-7334.12493772
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956