You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial dicarboxylate transporter
Synonyms
  • DTP
  • Dicarboxylate carrier 1
Gene NameDIC1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in antiporter activity
Specific FunctionMitochondrial dicarboxylic transporter catalyzing the exchange of dicarboxylic acids like malate and succinate for inorganic phosphate. Required for growth on ethanol and acetate
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB Pathways
Aspartate metabolismPW002375 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00280(S)-Malic acidShow
YMDB00338Succinic acidShow
GO Classification
Component
membrane
cell part
Function
binding
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 12
LocusYLR348C
Gene Sequence>897 bp ATGTCAACCAACGCAAAAGAGTCTGCCGGTAAGAATATCAAGTATCCATGGTGGTACGGA GGTGCAGCGGGTATCTTTGCTACCATGGTGACACATCCTCTTGACTTGGCCAAAGTCAGA CTGCAGGCGGCTCCTATGCCCAAGCCCACACTCTTCAGGATGTTGGAGAGTATCTTGGCG AATGAAGGTGTGGTGGGGTTATATTCCGGCCTGAGCGCTGCTGTGTTGAGGCAATGTACA TACACGACGGTGAGATTCGGTGCATACGACTTGTTGAAAGAGAATGTGATCCCACGCGAG CAATTGACTAACATGGCGTATCTTTTACCTTGCTCCATGTTCAGTGGTGCCATTGGGGGG CTTGCAGGGAATTTTGCAGATGTTGTAAATATCAGAATGCAAAACGACTCTGCTTTGGAG GCAGCGAAGAGGAGAAACTACAAAAACGCTATCGATGGTGTGTACAAGATATATCGCTAC GAGGGTGGACTGAAAACCTTGTTTACCGGTTGGAAGCCTAACATGGTTAGGGGCATACTG ATGACGGCAAGTCAGGTCGTTACGTATGACGTGTTTAAGAACTACTTGGTCACAAAATTA GATTTCGACGCATCCAAGAACTATACACACTTGACAGCGTCCCTGTTGGCTGGCCTGGTG GCCACCACTGTGTGCTCTCCAGCAGACGTCATGAAGACACGTATCATGAACGGCAGCGGA GACCATCAACCGGCTTTGAAGATCCTTGCCGACGCTGTCCGCAAAGAGGGCCCATCTTTC ATGTTCCGGGGGTGGTTGCCAAGTTTCACTAGACTGGGTCCATTCACAATGTTAATTTTC TTTGCAATTGAGCAATTGAAAAAACATAGGGTTGGCATGCCAAAGGAAGACAAGTAG
Protein Properties
Pfam Domain Function
Protein Residues298
Protein Molecular Weight32991.30078
Protein Theoretical pI10.1
Signalling Regions
  • None
Transmembrane Regions
  • 17-37
  • 58-76
  • 105-126
  • 170-189
  • 211-231
  • 265-283
Protein Sequence>Mitochondrial dicarboxylate transporter MSTNAKESAGKNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILA NEGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGG LAGNFADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGIL MTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSG DHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKHRVGMPKEDK
References
External Links
ResourceLink
Saccharomyces Genome Database DIC1
Uniprot IDQ06143
Uniprot NameDIC1_YEAST
GenBank Gene IDU19028
Genebank Protein ID609395
General Reference
  • Kakhniashvili, D., Mayor, J. A., Gremse, D. A., Xu, Y., Kaplan, R. S. (1997). "Identification of a novel gene encoding the yeast mitochondrial dicarboxylate transport protein via overexpression, purification, and characterization of its protein product." J Biol Chem 272:4516-4521.9020177
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Lancar-Benba, J., Foucher, B., Saint-Macary, M. (1996). "Characterization, purification and properties of the yeast mitochondrial dicarboxylate carrier (Saccharomyces cerevisiae)." Biochimie 78:195-200.8831951
  • Mayor, J. A., Kakhniashvili, D., Gremse, D. A., Campbell, C., Kramer, R., Schroers, A., Kaplan, R. S. (1997). "Bacterial overexpression of putative yeast mitochondrial transport proteins." J Bioenerg Biomembr 29:541-547.9559855
  • Palmieri, L., Vozza, A., Honlinger, A., Dietmeier, K., Palmisano, A., Zara, V., Palmieri, F. (1999). "The mitochondrial dicarboxylate carrier is essential for the growth of Saccharomyces cerevisiae on ethanol or acetate as the sole carbon source." Mol Microbiol 31:569-577.10027973
  • Zara, V., Palmisano, I., Rassow, J., Palmieri, F. (2001). "Biogenesis of the dicarboxylate carrier (DIC): translocation across the mitochondrial outer membrane and subsequent release from the TOM channel are membrane potential-independent." J Mol Biol 310:965-971.11502005
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Brandner, K., Rehling, P., Truscott, K. N. (2005). "The carboxyl-terminal third of the dicarboxylate carrier is crucial for productive association with the inner membrane twin-pore translocase." J Biol Chem 280:6215-6221.15591051