You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase YLR345W
Synonyms
  • 6-phosphofructo-2-kinase
  • Fructose-2,6-bisphosphatase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionSynthesis and degradation of fructose 2,6-bisphosphate
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00011D-Fructose 2,6-bisphosphateShow
YMDB00078Fructose 6-phosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
phosphotransferase activity, alcohol group as acceptor
catalytic activity
phosphofructokinase activity
transferase activity
6-phosphofructo-2-kinase activity
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
Process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
metabolic process
fructose metabolic process
fructose 2,6-bisphosphate metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYLR345W
Gene Sequence>1530 bp ATGCCAAATGTGCTTTCTGATGATGAAGAGCTCCTTAATGGACTAGGAAGTGAGATTATG AAACCCTCTAGACAAGGTAACCATATGGCAAGGACCGTCAAAAGGTGGGTAAATAAAGAA CGTGCTACCACAGCCGATCTGAAAAATGTTAATATTGATGGAGTTCATGGACCGGTAAAT ACCGAAAGTTATATATCACCAGGACAGCTTTACTCCACTGACTCGGGCAATTTATTTCAT GCTGGAAGAATCCTTGTCGTTCTAGTCGGTCTTCCAGCAACATCAAAGACACTATTGTCA GTAGCGATTACAAGATATACAAGATGGTTAGGAGTTAGGACGAAATCGTTCCATTTTTCA GAATATAAAGAATCAGCTAAAAATATACCCTCAGACTATTTTTGCGTAGTGCCAACGTCA AAAGAAGGTGTAGCGTTTGTTGAAAAGCTTCGCATGCAGATGTTGAATGATATACTGGCA TTTTTCAACGACTTGTCAGGTCAGCTGGCCATTTATGATGCCCTAAACATCCGTAAAATT GACAGAAAGAATTTGGAGACAACGTTTTCTGAAATTGGAGTTAAAGTACTCTTCATAGAA TCAATCGTGTCTGATCAAGAAATCATGAATAGAAACATAGCTCTTGCACTGGAGTCGAAC GATTACAAGGGACTTTCAACTGATGAAGCCATTGACGAATATATGAGACGTTTATCAGTG AACGAACCATACTATGAAATGATGACACATGACGAAGAATTATCGTACATTAAATATATA AATTTGGGAAAGCAGATAATTGTGAAAGATAACATACATGGTTATTTGGTCAACAAAATA GTATTTTTCTTAATGAATTTGAGGCAGAAAAAGGGGTGTGTATATTTTGCTCGCTGTGGC ACCAGCGATAAAGACAACTACATACATGATGAGGAACTAAACGAGGAGGGAATCCATTAC TCTCAAGTTCTCAAGGATTTTGTCCTCCAACGAATTAAACAGAAGAGACAGGCCAAAAAA AATTCGGATTCCTTAGTCGAAGTAATAGATGGAAGTCATGATGAAGATTTGAAGACTTCC TTGATAGTTTGGACAGGTCCCAGGAAAAGAACCCACGATACTGCACTCTTTTTTTCAAAA GAAGGTATTAAAGTTCAGCAACGGTCAGAGTTGAGACAGTTGAACCCAGGAAGTATTGCT GATCTTACTGATCAACAGATAATGGACAAATTTCCATCAGAATATAAAGAATCATTAAAA GACCCATATCATTTTCGATTCCCTAGGGCGGAATCTTACCATGACTTAGCCGTTCGTATG GAACCTTTACTATTAGAAATGGAGCATACGAGCAAGGACATTCTCATCATTGCACATGAG TCAACATTAAGAGTATTATATGGCTATTTAATGGCTTGCACCTGCGTAGAGTTACCAAAT CTAAATTTCACAAGAGACAAATTAGTTGAAATTTCATTCAGCCCTTTCTGTAATACTGTA GAGTTACTGAACATTCCTTTAACTAGCTAA
Protein Properties
Pfam Domain Function
Protein Residues509
Protein Molecular Weight58385.19922
Protein Theoretical pI6.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase YLR345W MPNVLSDDEELLNGLGSEIMKPSRQGNHMARTVKRWVNKERATTADLKNVNIDGVHGPVN TESYISPGQLYSTDSGNLFHAGRILVVLVGLPATSKTLLSVAITRYTRWLGVRTKSFHFS EYKESAKNIPSDYFCVVPTSKEGVAFVEKLRMQMLNDILAFFNDLSGQLAIYDALNIRKI DRKNLETTFSEIGVKVLFIESIVSDQEIMNRNIALALESNDYKGLSTDEAIDEYMRRLSV NEPYYEMMTHDEELSYIKYINLGKQIIVKDNIHGYLVNKIVFFLMNLRQKKGCVYFARCG TSDKDNYIHDEELNEEGIHYSQVLKDFVLQRIKQKRQAKKNSDSLVEVIDGSHDEDLKTS LIVWTGPRKRTHDTALFFSKEGIKVQQRSELRQLNPGSIADLTDQQIMDKFPSEYKESLK DPYHFRFPRAESYHDLAVRMEPLLLEMEHTSKDILIIAHESTLRVLYGYLMACTCVELPN LNFTRDKLVEISFSPFCNTVELLNIPLTS
References
External Links
ResourceLink
Saccharomyces Genome Database YLR345W
Uniprot IDQ06137
Uniprot NameYL345_YEAST
GenBank Gene IDU19028
Genebank Protein ID609382
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Zaim, J., Speina, E., Kierzek, A. M. (2005). "Identification of new genes regulated by the Crt1 transcription factor, an effector of the DNA damage checkpoint pathway in Saccharomyces cerevisiae." J Biol Chem 280:28-37.15494396
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956