You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameKynureninase
Synonyms
  • Biosynthesis of nicotinic acid protein 5
  • L-kynurenine hydrolase
Gene NameBNA5
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionCatalyzes the cleavage of L-kynurenine (L-Kyn) and L-3- hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3- hydroxyanthranilic acid (3-OHAA), respectively
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
NAD metabolismPW002421 ThumbThumb?image type=greyscaleThumb?image type=simple
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Tryptophan metabolismec00380 Map00380
SMPDB Reactions
L-3-Hydroxykynurenine + waterL-Alanine + hydron + 3-Hydroxyanthranilic acid
L-Kynurenine + waterhydron + L-Alanine + 2-Aminobenzoic acid
KEGG Reactions
L-3-Hydroxykynurenine + water3-Hydroxyanthranilic acid + L-Alanine
L-Kynurenine + water2-Aminobenzoic acid + L-Alanine + hydron
Metabolites
YMDB IDNameView
YMDB00105L-3-HydroxykynurenineShow
YMDB00154L-AlanineShow
YMDB002543-Hydroxyanthranilic acidShow
YMDB002782-Aminobenzoic acidShow
YMDB00375L-KynurenineShow
YMDB004623-HydroxyanthranilateShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
cofactor binding
pyridoxal phosphate binding
hydrolase activity, acting on acid carbon-carbon bonds
hydrolase activity, acting on acid carbon-carbon bonds, in ketonic substances
kynureninase activity
binding
hydrolase activity
Process
coenzyme metabolic process
coenzyme biosynthetic process
pyridine nucleotide biosynthetic process
nicotinamide nucleotide biosynthetic process
metabolic process
NAD biosynthetic process
cellular amino acid derivative metabolic process
cellular biogenic amine metabolic process
indolalkylamine metabolic process
tryptophan metabolic process
cellular metabolic process
tryptophan catabolic process
cellular amino acid and derivative metabolic process
cofactor metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR231C
Gene Sequence>1362 bp ATGGAGAAAGCTTTGGAATTAGACGGAGAATATCCGGAATCTCTGAGGGATGAATTCAAC ATCCCTACATTTAAATCCATGGGACTATCGTCCGACGATAAGCCTGTGACGTACTTATGC GGGAATTCTTTAGGTTTGATGCCGAAGTCAACTAGGAATTCAATTAATGCTGAGCTAGAT GCGTGGAGCGATTGTGCTGTGGAATCGCATTTCAAACATCCTGAAGAAGCCAGAGGAAAG GTGCCTTGGGTCAGCATTGACTTACCTATTCTTCCACTACTAGCCCCCATCGTGGGTGCT CAAGAAAATGAAGTTGCAGTAATGAATAGTCTCACTGCAAATTTGAATTCATTGTTAATT ACGTTTTATAAACCTACTGAGAAAAGATTCAAGATCCTTTTTGAAAAGGGCTCCTTTCCA TCAGACTATTATGCTTTCTACAACCAGTGCAAAATTCATGGAATTTCGGAACCTGAGAAT GTTTTTATTCAGATCGAGCCACGCGAGGGAGAGACTTATATCAGAACTCAAGATATCCTG GATACCATAGAGGTAAATCAAGATGAATTGGCGCTGGTCTGTTTGTCAGGTGTTCAGTAT TACACGGGGCAATATTTCGATATTGGCCGAATCACCTCATTTGCCCACCAATTCCCCGAC ATATTGGTTGGATGGGATTTAGCACACGCTGTAGGGAACGTCCCATTGCAACTTCATGAT TGGGGTGTTGACTTTGCCTGTTGGTGTTCTTACAAGTACTTGAATGCCGGGCCTGGTGGA ATTGGTGGCTTATTTGTCCACTCGAAGCATACTAAACCAGACCCTGCTAAGGAAAGTTTG CCAAGATTAGCTGGTTGGTGGGGCAATGATCCTGCTAAGCGATTTCAAATGCTGGAAGTA TTCGAGCCGATTCCAGGAGCATTGGGATTCAGGCAATCTAATCCAAGCGTTATTGACACA GTGGCATTGAGAAGTTCATTGGAATTATTTGCGAAGTTTAATGGTATTAATGAAGTTCGT AAAAGATCGTTGTTGCTGACGAACTATATGACGGAACTGTTGGAAGCCTCCAAGTATTAC AAACACCCTTTAAGGATCGAGAAATTACCATGTTTTTTTACAATATTAACTCCAACAAGC ACAGATGAAGAACATGGCGCCCAATTGTCACTTTACTTCGATTCTGACACTGGAAAAGAG GATATTATGCCCAAAGTTTTCCAATATTTGCATGACCATGGTGTCATTGGCGATGCAAGA AGACCAAACGTAATTAGATTGGCTCCTGCTCCCTTATATAATACATTTTCAGATGTATAC ATTGCGGTGAATGCACTAAATGAGGCGATGGATAAGTTGTAG
Protein Properties
Pfam Domain Function
Protein Residues453
Protein Molecular Weight51031.60156
Protein Theoretical pI4.94
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Kynureninase MEKALELDGEYPESLRDEFNIPTFKSMGLSSDDKPVTYLCGNSLGLMPKSTRNSINAELD AWSDCAVESHFKHPEEARGKVPWVSIDLPILPLLAPIVGAQENEVAVMNSLTANLNSLLI TFYKPTEKRFKILFEKGSFPSDYYAFYNQCKIHGISEPENVFIQIEPREGETYIRTQDIL DTIEVNQDELALVCLSGVQYYTGQYFDIGRITSFAHQFPDILVGWDLAHAVGNVPLQLHD WGVDFACWCSYKYLNAGPGGIGGLFVHSKHTKPDPAKESLPRLAGWWGNDPAKRFQMLEV FEPIPGALGFRQSNPSVIDTVALRSSLELFAKFNGINEVRKRSLLLTNYMTELLEASKYY KHPLRIEKLPCFFTILTPTSTDEEHGAQLSLYFDSDTGKEDIMPKVFQYLHDHGVIGDAR RPNVIRLAPAPLYNTFSDVYIAVNALNEAMDKL
References
External Links
ResourceLink
Saccharomyces Genome Database BNA5
Uniprot IDQ05979
Uniprot NameKYNU_YEAST
GenBank Gene IDU19027
Genebank Protein ID609377
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Panozzo, C., Nawara, M., Suski, C., Kucharczyka, R., Skoneczny, M., Becam, A. M., Rytka, J., Herbert, C. J. (2002). "Aerobic and anaerobic NAD+ metabolism in Saccharomyces cerevisiae." FEBS Lett 517:97-102.12062417
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106